PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G014900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 497aa    MW: 54164.2 Da    PI: 5.8743
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G014900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.7e-1766110147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  Prupe.3G014900.1.p  66 RERWTEEEHKKFLEALKLYGRA-WRKIEEHVG-TKTAVQIRSHAQKF 110
                         78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.86E-1760114IPR009057Homeodomain-like
PROSITE profilePS5129421.73361115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-963112IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-1764113IPR006447Myb domain, plants
SMARTSM007171.2E-1365113IPR001005SANT/Myb domain
PfamPF002493.1E-1466109IPR001005SANT/Myb domain
CDDcd001677.63E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MVGGLMLSPD MAAAQDQYDG SRSESVLSAN NGFSFSASGL QLKDQFSNGN DSAPKARKPY  60
TITKQRERWT EEEHKKFLEA LKLYGRAWRK IEEHVGTKTA VQIRSHAQKF FSKVARDSNG  120
SNEISEEPID IPPPRPKRKP MRPYPRKLVH PVNKETFIVE RPTRSASPNL SVSEPENQSP  180
TSVLSVIGSD TLGSADSNTP SRSLSPVSSA ADVHGVDLNQ SEPPNPSLEE SGSTSPAVAE  240
NGSLPNVQLS MKLELFPTDN VDASGVSSEE VSARSLKLFG RTVLVTDSHR PSSPTLGTSK  300
SLPSDVKEEK PVQISTPCNF TATESASGSV EHVWDNFPYG VHPGMYFMQF QNQNSNLVEP  360
GSAYPVPWWT LCPKLPFPFI PFHKPQAVKE HFDGNLGDPK EVEKEGSWTG SDAGSVNDEE  420
NGDKCLGIET EGKEQEPNSV LQFKASANSA FSELRASPSP GKCRKGFVPY KRCLAERDTS  480
TIASEDRDGK RVDLSL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.27110.0fruit| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008227906.10.0PREDICTED: LOW QUALITY PROTEIN: protein REVEILLE 1
TrEMBLM5X4Q80.0M5X4Q8_PRUPE; Uncharacterized protein
STRINGPOPTR_0017s01380.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.14e-69MYB_related family protein