PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G014400.1.p
Common NamePRUPE_ppa002384mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 683aa    MW: 77380 Da    PI: 5.5367
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G014400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.62e-5661331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtdeelv +yLk+k++g+k+el evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd
  Prupe.3G014400.1.p   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EVIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKD 95 
                         79****************************.99***************6434555777********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v s ++++vg+kktLv+y+grap+g +tdWvmheyrl
  Prupe.3G014400.1.p  96 RKVNS-QTRAVGMKKTLVYYRGRAPHGIRTDWVMHEYRL 133
                         *****.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-644158IPR003441NAC domain
PROSITE profilePS5100561.6916158IPR003441NAC domain
PfamPF023657.4E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEVIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVNS QTRAVGMKKT LVYYRGRAPH  120
GIRTDWVMHE YRLDERECET AQGLQVQDAY ALCRIFKKSA TGPKIGEHYG STSTTNYQLT  180
SDHSSSVELY SDGGRCEDFE SSSYPMQMNA CSSSPNFVHT SSLDMARKRD GKWTQFLSKD  240
AFNCSSSFSS FPNHGNVPYP PSKVDIALEC ARLQHRLSLP PLEVEDFPQV GINDFKTMQY  300
SNPAVEPTST ETDALQEILS VAHVSQEMIN QSSNLADQTW GGNYAAPAND FSFIVDRDAH  360
YNQIADHMNS MRYVDKSWEN PYTRPIDIGD LEDDFRMENT AENLRWVGIS DKYLEKSFME  420
ENKVVPLENI SGFRREEQEH EVQVAGETGD QSGMIKEFND SETNDDFSLG FINEDPNDNF  480
LNDGTMDDYS PSPSFEVIEE IQVNHGMFVS TRQVAETFFH QLMPSQTVKV HLNPVLGHNV  540
FVERVDTQTK CENIGSFFES FKAFGMDKFV GVSKSTKPWR KFASTLVCAV TLLLMHIIYF  600
GQHVEDEKLM DAFTTTTTAA IVEEKGNSTV SKKKRLGLIK WSNKEEKVCL VNIRGGNSCS  660
VLLKKIGVFL TVSLALCTMW AL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-56215811168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.3G014400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1518226e-46AC151822.29 Medicago truncatula clone mth2-32h21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020414575.10.0NAC domain-containing protein 86 isoform X1
TrEMBLA0A251PWQ60.0A0A251PWQ6_PRUPE; Uncharacterized protein
STRINGEMJ162000.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-166NAC domain containing protein 28