PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G327900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 784aa    MW: 89877.5 Da    PI: 7.2363
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G327900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR183.82.7e-2665150291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fY++YAk+vGF + k +s++s+ ++e+++++f C ++g++++++++     ++r++ ++gCka+++vk++ +g+w+v+++++eHnHel p
  Prupe.2G327900.1.p  65 FYKAYAKSVGFGTAKLSSRRSRASKEFIDAKFSCIRYGNKQQSDDA----INPRPSPKIGCKASMHVKRRPNGNWYVYSFVKEHNHELLP 150
                         ****************************************999877....9************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.3E-2465150IPR004330FAR1 DNA binding domain
PfamPF105514.3E-31263356IPR018289MULE transposase domain
PROSITE profilePS5096610.695543579IPR007527Zinc finger, SWIM-type
PfamPF044347.2E-9545577IPR007527Zinc finger, SWIM-type
SMARTSM005752.8E-7554581IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 784 aa     Download sequence    Send to blast
MFMGPMKTFR PFASAFEGEV HGGCRVDLNF PTTLMDSNTL TLTATSTLEP HDAMEFESHE  60
AAYTFYKAYA KSVGFGTAKL SSRRSRASKE FIDAKFSCIR YGNKQQSDDA INPRPSPKIG  120
CKASMHVKRR PNGNWYVYSF VKEHNHELLP AQAHFFRSHR NTDPLNNDVR IRRRKNLAAV  180
SSLFSAYQNV DCLESYLRNQ HDKGRSLVLE AGDAQVLLEY FMCMQEENPK FFYAVDLNEE  240
HRLRNVFWVD AKGMEDYTNF NDVVFFDTTY FTNKYKIPLV LFIGVNHHIQ PTLLGCALIA  300
DETVYTFVWL MQTWFIAMGE QAPRVILTDQ NNAIKAAIAA VFPGTSHCFC LWHIMEKIHR  360
HLEFLSMWHD SFVGKFNKCI FKSWSEQQFE KRWWKLLDRF NLREVEWMQS LYEDRTHWVP  420
TFMRDISFAG LSPTSRSESL NSSFDKYIHG ETSLREFMER YRVILEDRYE EEAKSNFDAW  480
HETPELKSPS PFEKQMSLVY THEVFKNFQV EVLGAAACHL KKENEDGTST TYSVKDFEDN  540
QNYVVEWNES KSDIYCSCHS FEYKGYLCRH AIVVLQMSGV FTIPSKYILQ RWTNAAMSRH  600
AIGERLDEVQ SKVRRYNDLC RRAIILGEEG SLSQESYDVA LCAIKEALKQ CASLNNAVEN  660
NAKPNDSAIH GICGVDGENQ CSTASGDKLF GPKVSNANKT PRRAGSGKEV ARNENTASKK  720
GKVPHLEATS VGTQDGFHQM QLPDTRAMQL RNTVPSTMFQ NVASAAQFHN VASTHVHENH  780
LPQ*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G327900.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020412519.10.0protein FAR1-RELATED SEQUENCE 4
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLA0A251QQB10.0A0A251QQB1_PRUPE; Uncharacterized protein
STRINGXP_008234547.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.10.0FAR1-related sequence 4
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]