PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G320600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 545aa    MW: 60887.1 Da    PI: 4.6234
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G320600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.4e-52141411128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lp GfrF+Ptdeel+++yL+ k++g++ ++ +vi+e+d++k+ePwdLp  + +++++ ew+fF+++d+ky++g+r nrat +gyWkatgkd
  Prupe.2G320600.1.p  14 LPLGFRFRPTDEELIDYYLRSKINGNHKQV-TVIREIDVCKWEPWDLPdlSVIQTTDPEWFFFCPQDRKYPNGHRLNRATGKGYWKATGKD 103
                         699************************999.99**************96447778888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++s  + l+g+kktLvf++grapkg++t+Wvmheyr 
  Prupe.2G320600.1.p 104 RQIKS-ATILIGMKKTLVFHTGRAPKGKRTNWVMHEYRT 141
                         *****.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-607164IPR003441NAC domain
PROSITE profilePS5100555.98414164IPR003441NAC domain
PfamPF023651.3E-2715140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002230Biological Processpositive regulation of defense response to virus by host
GO:0002237Biological Processresponse to molecule of bacterial origin
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MLVVDMAVLS TNTLPLGFRF RPTDEELIDY YLRSKINGNH KQVTVIREID VCKWEPWDLP  60
DLSVIQTTDP EWFFFCPQDR KYPNGHRLNR ATGKGYWKAT GKDRQIKSAT ILIGMKKTLV  120
FHTGRAPKGK RTNWVMHEYR TTQKELDGTN PGQNPFVLCR LFKKQDETID DSNFAEVEPA  180
VSSSTAAISS PQDTQSDHAL GPTSPSFERL DEKPTKVECT IADYSNGMEP DTLQPVECPS  240
NTYNGYDAED QLNVPLEGLD MFYDPPQQPL FSPLHSQMQT ELYYCGSNNF NNGHQGVKIQ  300
YGTNDQDADI SEFLSSIFNS SGEHSDVDAF VAVPCETELQ NPVQSEGNID RKGPVQNEST  360
QIDCFLTGDA GTGIRLRTRE TQNPTSTENF ARQGDAPRRL RLQRKFEVLH CCNLSKDWNC  420
RPEDQETKPM AVEEIRDTEE KAIDAAVSDV VDAAVSDAVD AATDPPKKET MSTRLNFTPE  480
GSILTGERVP NAILQGSPAG HSMWSFAFLF RVVVVVAFLF IMLLAYGDFI SFEAAGSPLT  540
VRMA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-46916512166NO APICAL MERISTEM PROTEIN
1ut4_B7e-46916512166NO APICAL MERISTEM PROTEIN
1ut7_A7e-46916512166NO APICAL MERISTEM PROTEIN
1ut7_B7e-46916512166NO APICAL MERISTEM PROTEIN
3swm_A8e-46916515169NAC domain-containing protein 19
3swm_B8e-46916515169NAC domain-containing protein 19
3swm_C8e-46916515169NAC domain-containing protein 19
3swm_D8e-46916515169NAC domain-containing protein 19
3swp_A8e-46916515169NAC domain-containing protein 19
3swp_B8e-46916515169NAC domain-containing protein 19
3swp_C8e-46916515169NAC domain-containing protein 19
3swp_D8e-46916515169NAC domain-containing protein 19
4dul_A7e-46916512166NAC domain-containing protein 19
4dul_B7e-46916512166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.146760.0fruit
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250|UniProtKB:Q9SCK6, ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774, ECO:0000269|PubMed:18785827, ECO:0000269|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269|PubMed:11041886, ECO:0000269|PubMed:15629774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G320600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269|PubMed:24418554}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020412062.10.0NAC domain-containing protein 91
SwissprotQ9LKG81e-111NAC91_ARATH; NAC domain-containing protein 91
TrEMBLA0A251QPX40.0A0A251QPX4_PRUPE; Uncharacterized protein
STRINGXP_008234624.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55513353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.21e-113TCV-interacting protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ben Daniel BH, et al.
    Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.
    Physiol Plant, 2016. 157(4): p. 422-41
    [PMID:26923089]
  3. Li Y, et al.
    The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains.
    Virus Res., 2016. 222: p. 94-105
    [PMID:27288723]