PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G317500.1.p
Common NamePRUPE_ppa024293mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRF
Protein Properties Length: 547aa    MW: 59302 Da    PI: 7.5476
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G317500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.31.5e-24157200144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Prupe.2G317500.1.p 157 DPEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 200
                         79****************************************98 PP

2QLQ56.39.3e-2097131236
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                         +FT++Q+ +L++Q+++yKy++a++PvP +Ll++i 
  Prupe.2G317500.1.p  97 PFTNTQWKELERQAMIYKYMVASLPVPRDLLFPIN 131
                         8********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.5E-1196132IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.5E-1397130IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.17497132IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.586157201IPR014977WRC domain
PfamPF088791.7E-20158200IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MMMVHRDNHR RPFSSSERGE ADGPTCNRPP VTENYPNNNS VYDVAVAAAA GSSSSGGPVL  60
RGLQPFDISN ITTNTSISAH HTAFRSPGGM TTSLGFPFTN TQWKELERQA MIYKYMVASL  120
PVPRDLLFPI NRAPSGPTIS QSPLSSGFNL RLSNSTDPEP GRCKRTDGKK WRCSRDVAPD  180
QKYCERHMHR GRPRSRKHVE VHANTTTKRV RHDINQAPPT MSPATVSISN TTSINKNVCQ  240
TQFIGSTLQP YHQSPMFLDR DTVKAATFDS MNSASSDREP RSLDWLMMKG EPVQMATSDP  300
QWQHLMQSKT ELNSKIPFFD ANSSIFAQRS ENECFLNLNS YTNFNAGGED QPDNECNMFL  360
NPDVVSLDNP LLEETPRCFI DAWSKTVINE DTMANSVNNK DNSSAPSSGQ LSPSSLTLSM  420
GGYNSINEEM GQTQMSLGNN GNGMKPGLST WLSPPSWVAS APGGPLAEVL KPTTSAASNP  480
SSPITAATAN GELGSPLATT VSSPSGVLQK TFASLSDSSG NSSPTLASSR AKQPEIVSLW  540
LNQNKA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G317500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150352e-33AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020411994.10.0growth-regulating factor 7 isoform X2
TrEMBLA0A251QPM70.0A0A251QPM7_PRUPE; Uncharacterized protein
STRINGXP_008234659.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.16e-37growth-regulating factor 7