PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G291400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HD-ZIP
Protein Properties Length: 809aa    MW: 88159.2 Da    PI: 6.5496
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G291400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.81.2e-20117172156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++k +++t++q++eLe++F+++++p++++r eL+++l+L+++qVk+WFqNrR+++k
  Prupe.2G291400.1.p 117 KKKYHRHTPSQIQELENFFKECPHPDEKQRLELSRRLSLETKQVKFWFQNRRTQMK 172
                         79999************************************************999 PP

2START173.61.2e-543275482206
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                         la +a++elvk+a+a++p+W k s    e++n +e++     +     + +e  r++ +v+ ++  lve+l+d + +W e++     +a++
  Prupe.2G291400.1.p 327 LAMAAMDELVKMAQADSPLWIKTSdggtEILNHEEYRAFSCIGTKpsnFVTEGTRDTCMVIINSLALVETLMDAN-RWAEMFSclvaRASV 416
                         57799*******************99999999999987655544466679*************************.*************** PP

                         EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
               START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                         ++ issg      galq+m aelq+lsplvp R   f+R+++q+++g+w++vdvS+d +q+ +++  +  ++++pSg+++++++n+ skvt
  Prupe.2G291400.1.p 417 IDMISSGmggtrnGALQVMHAELQVLSPLVPvRPLKFLRFCKQHQEGVWAVVDVSIDINQEGSSTNAFLNCRRFPSGCIVQDMPNNCSKVT 507
                         ******************************************************************************************* PP

                         EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         w+eh +++++++h l+ +l++sg+ +ga++w+atlqrqce+
  Prupe.2G291400.1.p 508 WIEHSEYDENTVHHLFWQLLRSGMGFGAQRWLATLQRQCEC 548
                         ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-21100172IPR009057Homeodomain-like
SuperFamilySSF466891.8E-20103174IPR009057Homeodomain-like
PROSITE profilePS5007117.702114174IPR001356Homeobox domain
SMARTSM003892.8E-18116178IPR001356Homeobox domain
PfamPF000463.1E-18117172IPR001356Homeobox domain
CDDcd000861.67E-19117174No hitNo description
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084842.981317551IPR002913START domain
SuperFamilySSF559619.2E-32318548No hitNo description
CDDcd088753.30E-113321547No hitNo description
SMARTSM002346.7E-37326548IPR002913START domain
PfamPF018521.7E-46327548IPR002913START domain
SuperFamilySSF559611.26E-14575802No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MSFGGLISGG SGNSGGGRAR VVADIAPHTP YMPSGAIAQP HFLTSPVPNS MRSSSSLSLS  60
IKNMDGHSEL GLIAENFDPG IIGRMRDDEY ESRSGSDNFE GASGDDQDAG DEQRPRKKKY  120
HRHTPSQIQE LENFFKECPH PDEKQRLELS RRLSLETKQV KFWFQNRRTQ MKTQLERHEN  180
IILRQENDKL RAENGVMKDS MANPVCNSCG GPAIPGQISF EEHHLRIENA RLKDELNRIC  240
TLANKFLGRS ISSLASPISL PNSTSGLELG VGRNGIGGLS AGGSGLPMGL NLGDGVSSSS  300
PMMPLIKSST GMLGNEVPYE RSMYIDLAMA AMDELVKMAQ ADSPLWIKTS DGGTEILNHE  360
EYRAFSCIGT KPSNFVTEGT RDTCMVIINS LALVETLMDA NRWAEMFSCL VARASVIDMI  420
SSGMGGTRNG ALQVMHAELQ VLSPLVPVRP LKFLRFCKQH QEGVWAVVDV SIDINQEGSS  480
TNAFLNCRRF PSGCIVQDMP NNCSKVTWIE HSEYDENTVH HLFWQLLRSG MGFGAQRWLA  540
TLQRQCECLA FLISSTNSIE DHTGLGTNGK KSMLKLAQRM IDNFCAGVSA SSVRKWDKLC  600
VNNVSEDLRV MARKSVDDPG EPAGIVLSGS TSVWLPVSRH RLFDFLRDEQ LRDQWDVLSK  660
THKMQLMLRI AKSQGGGNCV SLLRANVIDA NENTMLMLQE SWSDASGALV VYAPVDPASM  720
SAVMRGGDSA YVALLPSGFA ILPGGPPGYG MVKTEGNGCD DGGCFLTVGF QILGSNYPAA  780
KLDVQSINTV NTLVSHTIEK IKSALQVP*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G291400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007219555.20.0homeobox-leucine zipper protein HDG7 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A251QN550.0A0A251QN55_PRUPE; Uncharacterized protein
STRINGXP_008234278.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]