PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G288000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TCP
Protein Properties Length: 383aa    MW: 39726.1 Da    PI: 6.8911
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G288000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP112.74.9e-3585155373
                 TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                         ++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti WLl+ a+pai ++tgt++ +a ++
  Prupe.2G288000.1.p  85 AAKRSSKDRHTKVEGRGRRIRMPATCAARIFQLTRELGHKSDGETIRWLLEHAEPAIMQATGTGTVPAIAV 155
                         5799***********************************************************77777433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.5E-2889157IPR005333Transcription factor, TCP
PROSITE profilePS5136926.32890144IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEPNQRQSLE ESNELEQHSN SSSNDNTTSA SDPSVADPPE KIFPLTAPTM KEELTDTVQE  60
LDEGSLPMGL IQVPVPTSSE KQVVAAKRSS KDRHTKVEGR GRRIRMPATC AARIFQLTRE  120
LGHKSDGETI RWLLEHAEPA IMQATGTGTV PAIAVSVGGT LKIPTTSPAR PNGEITEIPR  180
KRRKRGSNSE FVDVHEQSSV SSGLAPMSYG GGGGGSGGGA HGLVPMWQVG ATGAAGPFFM  240
FPNNGAMNTN QPQLWAVPAA DAATPIFNFQ ARPISNFLSA FQPGVHVVGG DVQLQASSGS  300
ISSGATSGSG GSCSSSLGPS LGSASGTRAN KNTISTGSGT GASAAAAGAT TTQMLRDFSL  360
EIYDKRELQF MGANSQTPYS KP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G288000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007218212.20.0transcription factor TCP19
TrEMBLA0A251QN090.0A0A251QN09_PRUPE; Uncharacterized protein
STRINGXP_008234310.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.22e-62TCP family protein