PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G263700.1.p
Common NamePRUPE_ppa007645mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 361aa    MW: 39864.2 Da    PI: 6.1931
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G263700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.14.9e-10159207553
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                         kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +
  Prupe.2G263700.1.p 159 KRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQ 207
                         9****************************************99887655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-16155219IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657157220IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-8159213No hitNo description
SuperFamilySSF579599.85E-11159210No hitNo description
PfamPF001707.3E-9159207IPR004827Basic-leucine zipper domain
CDDcd147031.11E-23160209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MQDPANPKPD PSSSSQASQR PRMTTPFPDA SPSLSFRGSY HRRAQSEVQF RIPDDLDLLQ  60
DPFDGPSGSF EELGGSEDDL FCTYMDIEKL GSKLDDGPSD PKVENPGGSA ETGVELGGEM  120
SARPRHRHSN SVDASLDSIE AKKAMAPDKL AELWTVDPKR AKRILANRQS AARSKERKAR  180
YISELERKVQ TLQTEATTLS AQLTLFQRDT TGLSTENSEL KLRVQAMEQQ AQLRDALNDA  240
LKKELERLKI ATGEVLTHTD SYNMGMHQSP YSQSPFFPSQ SQAGQRDSQN IHMPQFHPFQ  300
PNMSAPHQPM LSAAQSHACS DMLQQDSIGR FQGLDISNRG SHLVRPEGPS ISAGESNRRF  360
*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}.
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G263700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007218181.10.0transcription factor RF2b
SwissprotO228731e-121BZP18_ARATH; bZIP transcription factor 18
TrEMBLM5XK210.0M5XK21_PRUPE; Uncharacterized protein
STRINGEMJ193800.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15483497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-115bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]