PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G261000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 224aa    MW: 24437.8 Da    PI: 8.9625
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G261000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.7e-42441431100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+
  Prupe.2G261000.1.p  44 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQ 134
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ael++++ e
  Prupe.2G261000.1.p 135 AELNAVRGE 143
                         ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.83243144IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4244140IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MSREREISDE IGKKIKRETD ASSHHRMGRR HMLGPPGTLN TITPCAACKL LRRRCAQECP  60
FSPYFSPHEP QKFASVHKVF GASNVSKMLM EVPESQRADA ANSLVYEANV RLRDPVYGCM  120
GAISALQQQV QSLQAELNAV RGEILKYKYR EANLLPSNSH HMALFSTSGA VSIASLPQTP  180
QPPPPPPPPP PLPPTSSSSS MYTNQPSTAD YSTLSSENVS FFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007218448.11e-144hypothetical protein PRUPE_ppa011757mg
SwissprotQ8L5T53e-90LBD15_ARATH; LOB domain-containing protein 15
TrEMBLM5X0N61e-144M5X0N6_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g02380.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-89LOB domain-containing protein 15