PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G256200.1.p
Common NamePRUPE_ppa012504mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 168aa    MW: 18718.3 Da    PI: 6.3359
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G256200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.12.1e-4561051100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lpe++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+
  Prupe.2G256200.1.p   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPEHQRADAVSSLVYEANARMRDPVYGCVGAISYLQNQVSELQ 96 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +la++++e
  Prupe.2G256200.1.p  97 MQLAVAQAE 105
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.5035106IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MVGTSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPEHQRA  60
DAVSSLVYEA NARMRDPVYG CVGAISYLQN QVSELQMQLA VAQAEILCIQ MQHEPTVPTP  120
QQILDTDEKS YFLPNNFPQY LNFTSSSSNV IHDSLKRESI FGQDMVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007218515.11e-123hypothetical protein PRUPE_ppa012504mg
SwissprotQ8LBW35e-79LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM5X1C11e-123M5X1C1_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s07280.16e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-80LBD family protein