PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G253700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 359aa    MW: 40308.5 Da    PI: 6.9969
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G253700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.9e-3277130255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          rlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  Prupe.2G253700.1.p  77 SRLRWTPDLHLCFVHAVERLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMYRS 130
                         69***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.84773133IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-3073131IPR009057Homeodomain-like
SuperFamilySSF466896.81E-1574131IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-2377132IPR006447Myb domain, plants
PfamPF002493.8E-978129IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MKSKSSTEEV SETSPSISKK EFEDEDDEGD EGEEEEVDKD SLQLRNNGVS SSNSTIEENE  60
KKGVSGSVRQ YVRSKTSRLR WTPDLHLCFV HAVERLGGQE RATPKLVLQL MNVKGLSIAH  120
VKSHLQMYRS KKMEDPDQVM SEQGFFMEGG DNHIYNLTQL SMLQSFNQWP SSGLRYGTAT  180
DAAWRGRQHQ IYSPYNTHRT ALLDHNTRNI GLYGSVADRI FGNNNNPTSA NNHLHTNNPS  240
PSYVQTTWRR HQIRDESFQS TIHVPCQDHS WKAIRDRQNL LKRKAPDSDH TTCDLDLNLS  300
LKVPQKDDHE FGKGLEGCSL SLSLTSSSSS KLSTKKLEGG GHGRGEHGRM PSTLDLTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-1877132257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-1877132257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-1877132257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-1877132257Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAPTransfer from AT2G40260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G253700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020413496.10.0uncharacterized protein LOC18786916
TrEMBLA0A251QPQ50.0A0A251QPQ5_PRUPE; Uncharacterized protein
STRINGEMJ221410.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.19e-52G2-like family protein