PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G253300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 190aa    MW: 20406.2 Da    PI: 7.337
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G253300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601292e-40141131100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+l+rkC++ C++apyf  ++pkkfa vhk+FGasnv+k+l+++pee+red+++sl+yeAear+rdPvyG++g i  lq+++ +l+
  Prupe.2G253300.1.p  14 SCAACKLLKRKCSPTCIFAPYFLPDEPKKFAKVHKVFGASNVSKILTEVPEEQREDTVNSLAYEAEARLRDPVYGCIGAIAMLQRKMIELQ 104
                         6****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++la ++++
  Prupe.2G253300.1.p 105 HDLAIARAR 113
                         ***999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.39713114IPR004883Lateral organ boundaries, LOB
PfamPF031954.7E-4014111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MNMKGSHEPR SSSSCAACKL LKRKCSPTCI FAPYFLPDEP KKFAKVHKVF GASNVSKILT  60
EVPEEQREDT VNSLAYEAEA RLRDPVYGCI GAIAMLQRKM IELQHDLAIA RARLACYASN  120
SLSSSSTTAS ASSCYGVLDD QLSEAAFSAV GFPACSGFSN SFMSQSAPEL ISHSQHGQTS  180
DFSCAPYIL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233787.11e-128PREDICTED: LOB domain-containing protein 21
SwissprotQ9SRL89e-63LBD21_ARATH; LOB domain-containing protein 21
TrEMBLM5X1A81e-124M5X1A8_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01450.t012e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59443353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.18e-63LOB domain-containing protein 21