PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G219500.3.p
Common NamePRUPE_ppa012182mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NF-YB
Protein Properties Length: 180aa    MW: 19059.1 Da    PI: 5.0437
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G219500.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB182.92.7e-5731127197
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         vreqdr+lPian+srimkk+lP+n+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy+epl++yl++yr
  Prupe.2G219500.3.p  31 VREQDRYLPIANISRIMKKALPQNGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLRIYLARYR 121
                         69***************************************************************************************** PP

               NF-YB  92 elegek 97 
                         eleg+ 
  Prupe.2G219500.3.p 122 ELEGDA 127
                         ***996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-5329135IPR009072Histone-fold
SuperFamilySSF471136.52E-4034136IPR009072Histone-fold
PfamPF008081.7E-2837101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-206583No hitNo description
PROSITE patternPS0068506884IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-2084102No hitNo description
PRINTSPR006151.3E-20103121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MAEAPTSPAG GSHESGGEQS PQGGGGGGSG VREQDRYLPI ANISRIMKKA LPQNGKIAKD  60
AKDTVQECVS EFISFVTSEA SDKCQKEKRK TINGDDLLWA MATLGFEDYI EPLRIYLARY  120
RELEGDAKGS ARGGDGSAKG NAIGAMPGPS SQFVHQGSLN YVNPQEEYYV PLNNMGNGN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-4830122193NF-YB
4awl_B9e-4930122294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A9e-4930122294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.103811e-130fruit| shoot
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233379.11e-131PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2
SwissprotQ8VYK41e-78NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLM5XKX81e-116M5XKX8_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s04440.12e-97(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.34e-74nuclear factor Y, subunit B8