PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G218000.1.p
Common NamePRUPE_ppa023989mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 232aa    MW: 25186.8 Da    PI: 6.7195
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G218000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.39.8e-42761751100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+++++l+
  Prupe.2G218000.1.p  76 PCAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQELPESHRADAVSSMVYEANARIRDPVYGCAGAICQLQKHVSELQ 166
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  Prupe.2G218000.1.p 167 AQLAKTQAE 175
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.93575176IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-4276173IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEFNTSTPSA SSPPLSISQL SSPTASFPSP NNSLQLSNLS SPNYAVKNNI NTNVNNPTSP  60
SPPPPPPPPP PVVLSPCAAC KILRRRCAEK CVLAPYFPPT EPLKFTIAHR VFGASNIIKL  120
LQELPESHRA DAVSSMVYEA NARIRDPVYG CAGAICQLQK HVSELQAQLA KTQAELLNMQ  180
CQQGNLIALI CMDMTQSKDP ILQQQQQQSY LDTSCFLDET NLGTAWEPLW T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007219697.11e-168hypothetical protein PRUPE_ppa023989mg
SwissprotQ9LQR03e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5X5X51e-168M5X5X5_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s04350.15e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-69LOB domain-containing protein 1