PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G204900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 184aa    MW: 21472.2 Da    PI: 4.7074
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G204900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM78.12e-2461296128
                 NAM   6 rFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk.......kvkaeekewyfFskrdkkya..tgkrknratksgyWkatg 87 
                           +Pt+e+lv  +L++k +      +++i+e+ i ++ Pwd p        + ++ ++ ++fFs+rd +y   +  r+n at++g+Wk+tg
  Prupe.2G204900.1.p   6 GLDPTEEQLV-SFLREKKQI-----DHIIPEIYIGNYVPWDVPGlyaglfaEPDSPHQPMFFFSPRDYRYIdnNYARTNSATARGFWKTTG 90 
                         569*******.889877443.....347***************54676654333455688*********98434569999*********** PP

                 NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         k++ +++  +  +   +tL+fy+gr p  ++t+W+mhey+l
  Prupe.2G204900.1.p  91 KERVIKA--RGSILRERTLIFYEGRVPPFNQTNWIMHEYSL 129
                         **99998..5569999***********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100526.3481154IPR003441NAC domain
PfamPF023656.6E-165129IPR003441NAC domain
SuperFamilySSF1019417.32E-255150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MNSYFGLDPT EEQLVSFLRE KKQIDHIIPE IYIGNYVPWD VPGLYAGLFA EPDSPHQPMF  60
FFSPRDYRYI DNNYARTNSA TARGFWKTTG KERVIKARGS ILRERTLIFY EGRVPPFNQT  120
NWIMHEYSLI EDEANPTPEL AQQRGFVLCC LKKIQEKKDS SIFAQPDEWP LISEEYPQPE  180
EPE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-18515621167NO APICAL MERISTEM PROTEIN
1ut4_B1e-18515621167NO APICAL MERISTEM PROTEIN
1ut7_A1e-18515621167NO APICAL MERISTEM PROTEIN
1ut7_B1e-18515621167NO APICAL MERISTEM PROTEIN
3swm_A2e-18515624170NAC domain-containing protein 19
3swm_B2e-18515624170NAC domain-containing protein 19
3swm_C2e-18515624170NAC domain-containing protein 19
3swm_D2e-18515624170NAC domain-containing protein 19
3swp_A2e-18515624170NAC domain-containing protein 19
3swp_B2e-18515624170NAC domain-containing protein 19
3swp_C2e-18515624170NAC domain-containing protein 19
3swp_D2e-18515624170NAC domain-containing protein 19
4dul_A1e-18515621167NAC domain-containing protein 19
4dul_B1e-18515621167NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G204900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007219787.21e-135NAC domain-containing protein 86
TrEMBLA0A251QM421e-134A0A251QM42_PRUPE; Uncharacterized protein
STRINGEMJ209861e-103(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3984922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.15e-27NAC domain containing protein 86