PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G204700.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 222aa    MW: 26073.7 Da    PI: 7.7419
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G204700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM138.34.7e-43111393128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyat.gkrknratksgyWkatgkd 89 
                          GfrF+Pt+eelv++yL+kk ++k+++++++i+e+di+k+ePw+Lp    + ++  ++++fFs+rd ky +   r+nr+tk+g+Wk+tgk+
  Prupe.2G204700.2.p  11 CGFRFRPTEEELVNYYLRKKKQDKDFKVDHIIPEIDICKYEPWELPGlftEPESPYQDMFFFSPRDYKYINnRARTNRVTKRGFWKTTGKE 101
                         6***************************999***************6233333344588**********96378***************** PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         + ++   +   g kktL+fy+gr  + ++t+Wvmhey l
  Prupe.2G204700.2.p 102 RVIKG-ARGSNGRKKTLIFYEGRVTQCNRTNWVMHEYYL 139
                         *9999.77789**************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-457164IPR003441NAC domain
PROSITE profilePS5100545.7759164IPR003441NAC domain
PfamPF023652.1E-2412138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MSAKLVWAMD CGFRFRPTEE ELVNYYLRKK KQDKDFKVDH IIPEIDICKY EPWELPGLFT  60
EPESPYQDMF FFSPRDYKYI NNRARTNRVT KRGFWKTTGK ERVIKGARGS NGRKKTLIFY  120
EGRVTQCNRT NWVMHEYYLC EDEAIPNPKL AQQRDFVLCR LSKKADKHET SICAVAQPAY  180
AEWVGNSEEC SQPEELELVF PAHQLQDNIS GEMEFEISSK K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-33816416165NO APICAL MERISTEM PROTEIN
1ut4_B2e-33816416165NO APICAL MERISTEM PROTEIN
1ut7_A2e-33816416165NO APICAL MERISTEM PROTEIN
1ut7_B2e-33816416165NO APICAL MERISTEM PROTEIN
3swm_A3e-33816419168NAC domain-containing protein 19
3swm_B3e-33816419168NAC domain-containing protein 19
3swm_C3e-33816419168NAC domain-containing protein 19
3swm_D3e-33816419168NAC domain-containing protein 19
3swp_A3e-33816419168NAC domain-containing protein 19
3swp_B3e-33816419168NAC domain-containing protein 19
3swp_C3e-33816419168NAC domain-containing protein 19
3swp_D3e-33816419168NAC domain-containing protein 19
4dul_A2e-33816416165NAC domain-containing protein 19
4dul_B2e-33816416165NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, rosette leaves, cauline leaves, shoot apex, stems and flowers. {ECO:0000269|PubMed:17158162}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). {ECO:0000250|UniProtKB:Q949N0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G204700.2.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, heat and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007219610.21e-161NAC domain-containing protein 86
SwissprotB5X5706e-42NAC14_ARATH; NAC domain-containing protein 14
TrEMBLA0A251QIW01e-166A0A251QIW0_PRUPE; Uncharacterized protein
STRINGXP_008233242.11e-141(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.12e-44NAC 014