PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G202600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 129aa    MW: 14531.5 Da    PI: 6.3545
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G202600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.69e-181563149
                 NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                        +p+GfrFhPt+eelv++yL+kk ++k+++++++i+e+  +k+ePwdLp 
  Prupe.2G202600.1.p 15 VPVGFRFHPTEEELVNHYLRKKKQDKDFKVNHIIPEIAFCKHEPWDLPG 63
                        599***************************999**************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-181072IPR003441NAC domain
PROSITE profilePS5100515.31115128IPR003441NAC domain
PfamPF023654.8E-91674IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MDSKCNRKTT GRVSVPVGFR FHPTEEELVN HYLRKKKQDK DFKVNHIIPE IAFCKHEPWD  60
LPGLLFTESG SWEEANVGGG GASMTKRPRN EEGEEGAIVP PPTIHPERMK DFLDTARLVL  120
SGEMSWEV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G202600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020412381.19e-92NAC domain-containing protein 100-like
TrEMBLA0A251QIN52e-90A0A251QIN5_PRUPE; Uncharacterized protein
STRINGXP_008244231.14e-40(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16106410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.12e-17NAC 014