PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G202400.6.p
Common NamePRUPE_ppa021740mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 420aa    MW: 47395.8 Da    PI: 4.7752
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G202400.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM87.62.4e-276018014128
                 NAM  14 lvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 
                         l  ++Lk+ ++gk  ++ ++i+++d++k+eP+dL +        + + w+ Fs+ + k+ ++ r nratk+g+Wk tgk +e++s+  +++
  Prupe.2G202400.6.p  60 LFLRFLKQMMQGKASQACHIIPQIDVCKYEPSDLAEllfpDSPYQPRMWFSFSRPHYKSINSLRYNRATKKGFWKITGKPREIKSQqlSKS 150
                         6678**********999999**************85455533447789*************************************976666 PP

                 NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                         ++  k+tL+f++gr +k++ktdWvm+ey l
  Prupe.2G202400.6.p 151 VTCKKRTLTFHEGRVSKSTKTDWVMQEYYL 180
                         677789**********************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-51055IPR003441NAC domain
PfamPF023653.0E-1515179IPR003441NAC domain
PROSITE profilePS5100530.30947203IPR003441NAC domain
SuperFamilySSF1019418.5E-3160203IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MRSTTTEEWL LPLLRGFRFH PPEEEMVNLL RKKMEGQGSQ TMPEIDYEPW NLPDNESISL  60
FLRFLKQMMQ GKASQACHII PQIDVCKYEP SDLAELLFPD SPYQPRMWFS FSRPHYKSIN  120
SLRYNRATKK GFWKITGKPR EIKSQQLSKS VTCKKRTLTF HEGRVSKSTK TDWVMQEYYL  180
TQTEPGSIPN QLSDFVLCRM KNKSAHYESN NKKLKDDSIC DESADPGIGG YMASNSEDDQ  240
APANNMILEA DRHLADKELE HDLPGSGNHD AGEPGGCVSS DCDDMVQELS AQPGEYLDLP  300
FPPPEPPEPG NASVPSPIGN NDSSLPNKNN ITTNYDSKPV SNTASNFKNQ TKDERTSEVY  360
SQPEEDPESF LQLKLDDYTW LSRILQPEQG NLLHANNSIG CNELQSPYPE TAALFPQSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-1612093174Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G202400.6.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007220850.20.0uncharacterized protein LOC18786544
TrEMBLA0A251QLZ40.0A0A251QLZ4_PRUPE; Uncharacterized protein
STRINGEMJ220490.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.31e-26NAC transcription factor-like 9