PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G202400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 455aa    MW: 51256.4 Da    PI: 5.0586
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G202400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM87.52.4e-279521514128
                 NAM  14 lvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kge 98 
                         l  ++Lk+ ++gk  ++ ++i+++d++k+eP+dL +        + + w+ Fs+ + k+ ++ r nratk+g+Wk tgk +e++s+  +++
  Prupe.2G202400.1.p  95 LFLRFLKQMMQGKASQACHIIPQIDVCKYEPSDLAEllfpDSPYQPRMWFSFSRPHYKSINSLRYNRATKKGFWKITGKPREIKSQqlSKS 185
                         66789*********999999**************85455533447789*************************************976666 PP

                 NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                         ++  k+tL+f++gr +k++ktdWvm+ey l
  Prupe.2G202400.1.p 186 VTCKKRTLTFHEGRVSKSTKTDWVMQEYYL 215
                         677789**********************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-54590IPR003441NAC domain
PfamPF023653.5E-1550214IPR003441NAC domain
PROSITE profilePS5100530.30982238IPR003441NAC domain
SuperFamilySSF1019411.01E-3095238IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MYVQEETLVG KLRTFGMKHK SKTAVTVLWL VVAGGMRSTT TEEWLLPLLR GFRFHPPEEE  60
MVNLLRKKME GQGSQTMPEI DYEPWNLPDN ESISLFLRFL KQMMQGKASQ ACHIIPQIDV  120
CKYEPSDLAE LLFPDSPYQP RMWFSFSRPH YKSINSLRYN RATKKGFWKI TGKPREIKSQ  180
QLSKSVTCKK RTLTFHEGRV SKSTKTDWVM QEYYLTQTEP GSIPNQLSDF VLCRMKNKSA  240
HYESNNKKLK DDSICDESAD PGIGGYMASN SEDDQAPANN MILEADRHLA DKELEHDLPG  300
SGNHDAGEPG GCVSSDCDDM VQELSAQPGE YLDLPFPPPE PPEPGNASVP SPIGNNDSSL  360
PNKNNITTNY DSKPVSNTAS NFKNQTKDER TSEVYSQPEE DPESFLQLKL DDYTWLSRIL  420
QPEQGNLLHA NNSIGCNELQ SPYPETAALF PQSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-17352442174Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G202400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007220850.20.0uncharacterized protein LOC18786544
TrEMBLA0A251QLZ40.0A0A251QLZ4_PRUPE; Uncharacterized protein
STRINGEMJ220490.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3993322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.11e-26NAC transcription factor-like 9