PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G200400.1.p
Common NamePRUPE_ppa001765mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 769aa    MW: 83697.6 Da    PI: 6.1279
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G200400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-162468147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rWT+eE+ +++da k++G   W +I +++g ++t+ q++s+ qk+
  Prupe.2G200400.1.p 24 RERWTEEEHNRFLDALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.7451973IPR017930Myb domain
TIGRFAMsTIGR015579.7E-172271IPR006447Myb domain, plants
SMARTSM007171.1E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-82464IPR009057Homeodomain-like
PfamPF002494.3E-132467IPR001005SANT/Myb domain
CDDcd001672.30E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    Send to blast
MDTQSSGEDL VIKARKPYTI TKQRERWTEE EHNRFLDALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAHNKG VLAGQSIDID IPPPRPKRKP SNPYPRKSCS AAPTWATSHV  120
AAKDGKLLSS TSSSHCKQVL DLEKEPLDER PTKEENPRNG KENQDENCSE VLTMLLEDHC  180
SSVSSANKNS IPTQVALRNA CTFREFVPSP KEVISQDVTN DSYVTTELNG NQNLKKNDAK  240
KIVQDNGTSG ASESENSNAF HKKLVQGEKA DDLNCALPTD GMQGTQTYPR NVPVHVLDGS  300
LGACNQITPA DMSFADTAFH PMGKVHGQPN LFANPTASTT TEHESNTSRS SVHQSFPAFH  360
PPFTPLHHGQ KDYQSFLHMS STFSSLIVSS LLQNPAAHAA ASFAATFWPY ANAENTEDSP  420
ACPPGGFPSR QMNSPPSMAA IAAATVAAAS AWWASHGLLP LCAPVQTAFS CPPVSMTGVP  480
SMDTGEAPAA NIERGENSLQ IPSLQDQQVD PEHLEAVEAQ HPASKSPSMS SSHSDNGGAE  540
PNTVLKAAAD EKVVASTDEV NDSNNAKSRK QVDRSSCGSN TPSSSEVETD ALEKQEKGKE  600
ELKEPDLNHP ASDSTYRRSR SIINISDPWK EVSEEGRMAF QALFSREVLP QSFSPPPKDK  660
EHQTTTEGKE NAEEKDEDAS LLDLNKKTWV PFSCHLGVEK NVSPVGDNDA EGLLTIGLSQ  720
GKLKARRTGF KPYKRCSVEA NENRAANAIS HCEEKGPKRL RLEGEAQT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.23060.0fruit| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007218929.10.0hypothetical protein PRUPE_ppa001765mg
TrEMBLM5XF420.0M5XF42_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g02410.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-113MYB_related family protein