PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G200300.6.p
Common NamePRUPE_ppa004107mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 404aa    MW: 44713.6 Da    PI: 9.5289
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G200300.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.3e-152468147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r rWT eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  Prupe.2G200300.6.p 24 RERWTHEEHNKFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                        78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.4151973IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.7E-92170IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-162271IPR006447Myb domain, plants
SMARTSM007172.2E-122371IPR001005SANT/Myb domain
PfamPF002495.4E-132467IPR001005SANT/Myb domain
CDDcd001673.59E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MEPHSSREDL AIKARKPYTI TKQRERWTHE EHNKFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAHVNG VPIGQSIGID IPPPRPKRKP SNPYPRKSSS AASTCATLHV  120
GAKVGKLLSS ASSSRYKQVV DLEKEPLHER PFGEEKANNA ENQVALGNAC TLRDATNESH  180
VTIKLKGNQN LKKIDAKMIV GDNGTSGAPK SGNTNNAFHK ELVQVPSMDT DQAPPAKRER  240
GESSLQIPSL QDQQLDSKHT EAVEAQHSNI AKANTDDKKD VASTGEVHDS NPAKSRKQQV  300
DRSSYGSNTP SDSKDETAAI EKNEKGKEEQ KEPNTSHPAA ESSHRRSRCV SNVYDSWKEV  360
SEEGRLAFHA LFSRDVLPQS FSLTQDLKIK GHQNDGMEDS KKS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008244200.10.0PREDICTED: protein LHY-like isoform X1
SwissprotQ6R0H16e-52LHY_ARATH; Protein LHY
TrEMBLM5XFB21e-123M5XFB2_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g02410.t012e-71(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.47e-48MYB_related family protein