PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G191100.1.p
Common NamePRUPE_ppa025888mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 155aa    MW: 17763.5 Da    PI: 6.9396
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G191100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601253.7e-39151141100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaC++lrr+C ++C lapyfp e+ +kfa vhk+FGasnv+k+++ ++e++reda+++lvyeA+ar+rdPvyG++g i++lq+ +e+l+
  Prupe.2G191100.1.p  15 PCAACRMLRRRCDRNCSLAPYFPGEEIEKFAGVHKVFGASNVIKMIQMVEETRREDAVKALVYEARARLRDPVYGSTGAIFHLQKMIEELR 105
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++l++++++
  Prupe.2G191100.1.p 106 SQLESIRSQ 114
                         ***999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.240.109.7E-4929IPR001138Zn(2)-C6 fungal-type DNA-binding domain
PROSITE profilePS5089125.5214115IPR004883Lateral organ boundaries, LOB
PfamPF031955.7E-3915112IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDTQVVPMHN RVHQPCAACR MLRRRCDRNC SLAPYFPGEE IEKFAGVHKV FGASNVIKMI  60
QMVEETRRED AVKALVYEAR ARLRDPVYGS TGAIFHLQKM IEELRSQLES IRSQVLELQQ  120
HRDQLLGILM NNVHCLEDDL FSTMHHDPMF GGDL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233120.11e-110PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR05e-43LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5XHG31e-107M5XHG3_PRUPE; Uncharacterized protein
STRINGVIT_15s0046g00230.t015e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF140681921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-44LOB domain-containing protein 1