PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G177800.1.p
Common NamePRUPE_ppa015755mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 222aa    MW: 24761.9 Da    PI: 9.5288
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G177800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.98.8e-33142200159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK vk++ +prsYYrCt+++C+vkk+v+r ++d+++v++tYeg+Hnh+
  Prupe.2G177800.1.p 142 LDDGYRWRKYGQKAVKNNLYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGTHNHP 200
                         59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-33128200IPR003657WRKY domain
SuperFamilySSF1182901.83E-28135201IPR003657WRKY domain
PROSITE profilePS5081129.264137202IPR003657WRKY domain
SMARTSM007746.0E-38142201IPR003657WRKY domain
PfamPF031061.8E-26143200IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEGHQEPNYP PPLTPSSLIS LPFLLPPQNP LFTPSSASTA PSSSSQLISP PLLEPQQHQV  60
LPDIDWVSLL SGSPAAVFDG QEINNYKPLV ENNNVGASAE NINEADREGK GANSKRKGGG  120
RMRKPASRPR FAFQTRSADD ILDDGYRWRK YGQKAVKNNL YPRSYYRCTH HTCNVKKQVQ  180
RLSKDTSIVV TTYEGTHNHP CEKLMETLTP LLKQMQFLSR F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25132199774Probable WRKY transcription factor 4
2lex_A2e-25132199774Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G177800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007219115.11e-165probable WRKY transcription factor 56
TrEMBLM5X3041e-164M5X304_PRUPE; Uncharacterized protein
STRINGEMJ203141e-165(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32273471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46130.12e-56WRKY DNA-binding protein 43