PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G176200.2.p
Common NamePRUPE_ppa008029mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 347aa    MW: 37933.6 Da    PI: 7.99
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G176200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.7e-1378122147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Prupe.2G176200.2.p  78 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 122
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-1672128IPR009057Homeodomain-like
PROSITE profilePS5129415.40873127IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-676128IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-1876125IPR006447Myb domain, plants
SMARTSM007175.3E-1177125IPR001005SANT/Myb domain
PfamPF002492.9E-1178122IPR001005SANT/Myb domain
CDDcd001672.26E-880123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MVSVNPNPAQ GFYLFDPMNM GLPGLNSMPP PTATATTASA ATSTTACTAS STPTNATSLL  60
AEDQSKKIRK PYTITKSRES WTEQEHDKFL EALQLFDRDW KKIEAFVGSK TVIQIRSHAQ  120
KYFLKVQKKG TSEHVPPPRP KRKATHPYPQ KAPKSVVSQV AGQFQSSSAL LNGYVYQPDS  180
SFALGTPVTS ATLSSWSYNS VPPVNVSQIT KDDGRLAGPT VAHNSCYSSS NESNPTTWQM  240
SEKVDQADPG QPHRVLPDFA QVYKFIGSVF DPNATSHLER LKELDPINLE TVLLLMRNLS  300
LNLTSPEFED HRKLLSSYDA DSEKAISDSN CNFSCIGKSE NAILSA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3815657e-72FQ381565.1 Vitis vinifera clone SS0ABP1YE10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007218242.10.0hypothetical protein PRUPE_ppa008029mg
SwissprotQ6R0H01e-113RVE3_ARATH; Protein REVEILLE 3
TrEMBLM5X1R60.0M5X1R6_PRUPE; Uncharacterized protein
STRINGPOPTR_0014s08520.11e-168(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.11e-100MYB_related family protein