PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G138400.6.p
Common NamePRUPE_ppa001781mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 704aa    MW: 77280.7 Da    PI: 5.8603
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G138400.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS326.35.9e-1003447022374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         +++L+++Ae +++g+ +laq +Larl+++ sp g+p+qR+a+yf+eAL+  l+   ++  ++ + s+    + + ++ a+k fse+sP+l+
  Prupe.2G138400.6.p 344 IDQLFNAAELIETGNPALAQGILARLNHQLSPVGKPFQRAAFYFKEALQLLLHI-NTSSNSSNALSPF---SLIFKIGAYKSFSEISPVLQ 430
                         689***********************************************9998.3333333444444...49****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                         f+++t+NqaIleaveg +rvH+iDfdi++G+QW++++q+ a R+ g+ps++iT++ s++++++ e+  t+e+L++fA+el+++fe +++  
  Prupe.2G138400.6.p 431 FANFTCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEVALRNCGAPSFKITAFISSSTHDEFEIGFTRENLKHFASELNLSFELELVSL 521
                         *********************************************************9*9***************************9744 PP

                GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                         ++l+    + L ++  E +aV + l + ++ ++++sl+      L++vk+lsPk+vv  ++ +d+++ +F+++++++l+ ys l++sl+a 
  Prupe.2G138400.6.p 522 EALN-SGSWGLPLHVSEGVAVAVNLPIGSFSNNPLSLTM----ALRFVKQLSPKIVVSLDRGSDRTDVPFAHQIIQSLHSYSGLLESLDAV 607
                         4444.4467776666777777777777888889999999....*********************************************665 PP

                GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdr 365
                            + ++ +k+Er ll++ i+++v+ ++ +     ++   Wr  ++++GF+p+++s+++++qa++l++++++ g+++e+++ slvl+W+++
  Prupe.2G138400.6.p 608 -NVNPDALQKIERYLLQPGIEKIVTGRHLS----PKRTPPWRTLFSSSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQHK 693
                         .34668999****************99998....9999***************************************************** PP

                GRAS 366 pLvsvSaWr 374
                          L+svS+Wr
  Prupe.2G138400.6.p 694 DLISVSVWR 702
                         ********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.015317682IPR005202Transcription factor GRAS
PfamPF035142.0E-97344702IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MKAMPLPFEQ FQGKGVLDFS SSTSDSQPPQ NQHLHHHHNQ QQQQQKWNQN SNKENCYVGS  60
TEPTSVLDAR RSPSPPTSSS TLSSSLGGGG GASGGGGGGS GSTDTTTCLG TTAAAVYENI  120
SQTPIEESKC GPALGMEDWE SVLPESPGQE QSILRLIMSD IEDPSLGLNK LLQSGSGSDQ  180
QDLEFSAGFH DVVDQGGYDG FEPNTGNLQQ QQHMGMDEKP QIFNPQMVMN QNQAQFTQNP  240
AMFMPLTYAQ LQEHHLLSPP PPKRFNSGGF GPNYPVQRAP FSNPGQELLV RAQQQQQQLQ  300
FLPQHLQQQR PTMLVKENML SPAEGTKEMM NQNQNQQQLQ QAAIDQLFNA AELIETGNPA  360
LAQGILARLN HQLSPVGKPF QRAAFYFKEA LQLLLHINTS SNSSNALSPF SLIFKIGAYK  420
SFSEISPVLQ FANFTCNQAI LEAVEGFNRV HVIDFDIGYG GQWASFMQEV ALRNCGAPSF  480
KITAFISSST HDEFEIGFTR ENLKHFASEL NLSFELELVS LEALNSGSWG LPLHVSEGVA  540
VAVNLPIGSF SNNPLSLTMA LRFVKQLSPK IVVSLDRGSD RTDVPFAHQI IQSLHSYSGL  600
LESLDAVNVN PDALQKIERY LLQPGIEKIV TGRHLSPKRT PPWRTLFSSS GFSPLTFSNF  660
TESQAECLVQ RTPVGGFHIE KRQSSLVLCW QHKDLISVSV WRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3135870218375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008232583.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 6
SwissprotO813161e-146SCL6_ARATH; Scarecrow-like protein 6
TrEMBLM5X7H70.0M5X7H7_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-141GRAS family protein