PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G135000.1.p
Common NamePRUPE_ppa024285mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family SBP
Protein Properties Length: 420aa    MW: 46264.8 Da    PI: 8.307
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G135000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1283.5e-40171248178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +CqvegC++ l +akeyhrrhkvCe+hska++v+v g+eqrfCqqCsrfh +sefDe+krsCrrrLa+hnerrrk+++
  Prupe.2G135000.1.p 171 RCQVEGCHVPLMNAKEYHRRHKVCEMHSKASKVTVLGQEQRFCQQCSRFHVVSEFDESKRSCRRRLAGHNERRRKSSH 248
                         6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.3E-33168233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.18169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.05E-38170251IPR004333Transcription factor, SBP-box
PfamPF031101.8E-31172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MEIGGNMNML GHDHNNNSHI SSSSRGQNGN NNTYLTNWDI WGGATSTNNN SFYSPAAVTV  60
AATTGASSSA TCSEASAGGH AFIMGHPLQQ QQSSFYGGGA RSHYHPDPHL MCLKLGKRHY  120
FEDHARAHAH ALDDRHVAGL PVGVMSKRGR GGAAQQLYGS GATLALKVVP RCQVEGCHVP  180
LMNAKEYHRR HKVCEMHSKA SKVTVLGQEQ RFCQQCSRFH VVSEFDESKR SCRRRLAGHN  240
ERRRKSSHDS LSRTSSQEKG RFGYLSTPTG RALSLLSSRN TGFDSWVSPS DLSSRSSAAL  300
RELIAENRAA VLARQLINSS EDRNWDSSSH NSHATEDLFC DHGQSWSNSV EPQQHQMFSD  360
HNYQHGWDRF HEGSGAHLTL DLRQAPSPAY GFLPERGKTK AEEDQECDLW NSFHGASVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29159245184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G135000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020412066.10.0squamosa promoter-binding-like protein 7
TrEMBLA0A251QGK40.0A0A251QGK4_PRUPE; Uncharacterized protein
STRINGEMJ221560.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.46e-36squamosa promoter binding protein-like 10