PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G091500.1.p
Common NamePRUPE_ppa003239mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 591aa    MW: 66058.2 Da    PI: 4.2906
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G091500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-5361331128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrFhPtdeelv++yLk+kv+gk++++ + i+ +diyk+ePwdLp k k+k+++ ewyfFs  dkky +++r+nrat++gyWk+tgkd
  Prupe.2G091500.1.p   6 LAPGFRFHPTDEELVWYYLKRKVSGKNFRF-DPISVIDIYKTEPWDLPgKsKLKTGDLEWYFFSFLDKKYGNSSRTNRATEKGYWKTTGKD 95 
                         579**************************9.99***************6348888999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++vl+ ++++vg+kktLvf++grapkg +t+Wvmheyrl
  Prupe.2G091500.1.p  96 RPVLH-NSRNVGMKKTLVFHSGRAPKGARTNWVMHEYRL 133
                         *****.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-613157IPR003441NAC domain
PROSITE profilePS5100557.8026157IPR003441NAC domain
PfamPF023658.8E-288133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 591 aa     Download sequence    Send to blast
MGRNSLAPGF RFHPTDEELV WYYLKRKVSG KNFRFDPISV IDIYKTEPWD LPGKSKLKTG  60
DLEWYFFSFL DKKYGNSSRT NRATEKGYWK TTGKDRPVLH NSRNVGMKKT LVFHSGRAPK  120
GARTNWVMHE YRLSNEELEK SGIPQKDPYV LCRIFQKSGT GPKNGEQYGA PIAEEEWDDD  180
DVTCVPGELA ADNVVVVSGG PYVETNDVSN GAYVEAFDND QNFDTGIPSE CPPLNFYYGE  240
TSNYVEHSGE FVDDGTTAVI GTGETTEYHE DQKFFDLPVD YEMGGKTVKD EYLTSENCDD  300
LKFFDVPEHY EADAKLVKDE CFIEPSNDTN PADVNYPLNE PYFNTTENPP VGDGLFLETN  360
DLSNPVESTA GFDMLDEYLT YFDADDDISQ YIDFDSCGMM GVENSVPDQS PVDQKLGNGE  420
TEQLPMGVEH LAQAEDTNDA SSSKQKPEFK LESDVNYPFI KKASHMMLGN IPAPPAFASE  480
FPAKDAILRL NSGAASSSSV HLTAGMIRIR DITSSDNRMD WSFGKDGVVN LVFSVQLSQN  540
DGNSGNLVPM DGSLSGKTGC VVMRGWFLFM FFWVLFLSMS FKIGSYVYTR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-46516319174NAC domain-containing protein 19
3swm_B1e-46516319174NAC domain-containing protein 19
3swm_C1e-46516319174NAC domain-containing protein 19
3swm_D1e-46516319174NAC domain-containing protein 19
3swp_A1e-46516319174NAC domain-containing protein 19
3swp_B1e-46516319174NAC domain-containing protein 19
3swp_C1e-46516319174NAC domain-containing protein 19
3swp_D1e-46516319174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.133770.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G091500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007218872.10.0NAC domain-containing protein 78 isoform X2
TrEMBLM5X3J70.0M5X3J7_PRUPE; Uncharacterized protein
STRINGEMJ200710.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53473247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-141NAC domain containing protein 2