PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G056800.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 319aa    MW: 35570.2 Da    PI: 8.7554
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G056800.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.69.8e-17252303556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+k+ ++ + + 
  Prupe.2G056800.3.p 252 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLRKQKKRVESQF 303
                         79*****************************************999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.6E-16241302No hitNo description
SMARTSM003386.7E-15248312IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.99250302IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.0E-12252303No hitNo description
CDDcd147075.93E-23252297No hitNo description
PfamPF001702.7E-13252301IPR004827Basic-leucine zipper domain
PROSITE patternPS000360255270IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGIQTMGSQG GADGNCKQSQ FQPLARQSSI YSLTLDEVQN QLGDLGKPLS SMNLDELLKN  60
VWSAEANQTM GMDIEGTTLV NQATLQRQAS LSLTSALSKK TVDEVWRDIQ QSKNNEEKKS  120
QERQRTLGEM TLEDFLVKAG VVAEAEASSD KKCSAPLAVV DANVASQFPQ GQWLQYQQPQ  180
YQHPQQSMMG VYMPSQPIPP PLHIGAGAIM EVPYPDNQVA LPSPLMGTLS DTQTPGRKRG  240
NPEDIVEKTV ERRQKRMIKN RESAARSRAR KQAYTNELEN KVSRLEEENE RLRKQKKRVE  300
SQFCSGTYQI VIMIRSIK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.196771e-171fruit
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.2G056800.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7863070.0AY786307.1 Malus x domestica bZIP transcription factor (ZIP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020413451.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES31e-84AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A251QBU80.0A0A251QBU8_PRUPE; Uncharacterized protein
STRINGEMJ198870.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.19e-75ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  2. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]