PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G028700.8.p
Common NamePRUPE_ppa005439mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 342aa    MW: 38881 Da    PI: 6.8366
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G028700.8.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS345.39.9e-1061433693374
                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                         ++++++NqaI+ea+ege++vHiiD+   +++QW+ L+q+L++Rpegpp+lRiTg+++    +ke l ++ +rL++ A +l++pf+fn+ ++
  Prupe.2G028700.8.p  14 VAYVVTNQAIVEAMEGEKMVHIIDLHSCEPAQWIYLIQTLNARPEGPPHLRITGIHE----QKEVLDQMFHRLTEEAGNLNIPFQFNP-IV 99 
                         689******************************************************....9**************************.79 PP

                GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrll.................................................desvsles.er 224
                         ++le+l++e+Lrvk+gEalaV++vlqlh+ll                                                    +s  s + 
  Prupe.2G028700.8.p 100 SKLENLDIESLRVKTGEALAVCSVLQLHSLLaadddlrrksplasknlqkvlhmnkltlgewlekdpisaynlspdsalsP--LSGGSpKM 188
                         99*************************************************************************888552..33333447 PP

                GRAS 225 devLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekW 315
                          ++L  +++lsPk++v++eqe++hn++++++r++eal++y alfd+le+++pr   er+kvE++l+g+ei+n++aceg+er+erhe+lekW
  Prupe.2G028700.8.p 189 GSFLTSLWGLSPKLMVITEQESNHNGHTLMDRIMEALNFYGALFDCLESTVPRSPMERQKVEKMLFGEEIKNIIACEGTERTERHEKLEKW 279
                         78***************************************************************************************** PP

                GRAS 316 rerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           rle aGF+ vpls++ + qa++ l+ ++  g++++ee+g+lv++W+drpL+s+SaWr
  Prupe.2G028700.8.p 280 ILRLELAGFGRVPLSYHGMLQARRQLQGYE--GFKIKEENGCLVICWHDRPLFSISAWR 336
                         *****************************9..**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.3351318IPR005202Transcription factor GRAS
PfamPF035143.4E-10314336IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MRHLQTGCLK LGLVAYVVTN QAIVEAMEGE KMVHIIDLHS CEPAQWIYLI QTLNARPEGP  60
PHLRITGIHE QKEVLDQMFH RLTEEAGNLN IPFQFNPIVS KLENLDIESL RVKTGEALAV  120
CSVLQLHSLL AADDDLRRKS PLASKNLQKV LHMNKLTLGE WLEKDPISAY NLSPDSALSP  180
LSGGSPKMGS FLTSLWGLSP KLMVITEQES NHNGHTLMDR IMEALNFYGA LFDCLESTVP  240
RSPMERQKVE KMLFGEEIKN IIACEGTERT ERHEKLEKWI LRLELAGFGR VPLSYHGMLQ  300
ARRQLQGYEG FKIKEENGCL VICWHDRPLF SISAWRFRRY E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-361533693375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245677.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008245676.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008231437.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008231436.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008231435.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_007217978.10.0hypothetical protein PRUPE_ppa005439mg
SwissprotQ9LPR81e-149SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM5WZE40.0M5WZE4_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s06090.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-150scarecrow-like 3