PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G028700.5.p
Common NamePRUPE_ppa005439mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 462aa    MW: 52324.3 Da    PI: 6.2812
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G028700.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS448.25.5e-137444561374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA++v+sg+ e+a+  L ++s+laspdgd+mqR+aayf eALa r+++ +++lykal++++ +  ++see+ + +lf +++P+l
  Prupe.2G028700.5.p  44 LIQLLYSCANHVASGSIENANIWLDHISQLASPDGDTMQRIAAYFNEALADRMLKAWPGLYKALNSTKIT--SVSEEILVKRLFCDLCPFL 132
                         689*************************************************************999998..5****************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         k++++++NqaI+ea+ege++vHiiD+   +++QW+ L+q+L++Rpegpp+lRiTg+++    +ke l ++ +rL++ A +l++pf+fn+ +
  Prupe.2G028700.5.p 133 KVAYVVTNQAIVEAMEGEKMVHIIDLHSCEPAQWIYLIQTLNARPEGPPHLRITGIHE----QKEVLDQMFHRLTEEAGNLNIPFQFNP-I 218
                         **********************************************************....9**************************.7 PP

                GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrll.................................................desvsles.e 223
                         +++le+l++e+Lrvk+gEalaV++vlqlh+ll                                                    +s  s +
  Prupe.2G028700.5.p 219 VSKLENLDIESLRVKTGEALAVCSVLQLHSLLaadddlrrksplasknlqkvlhmnkltlgewlekdpisaynlspdsalsP--LSGGSpK 307
                         999*************************************************************************888552..3333344 PP

                GRAS 224 rdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlek 314
                           ++L  +++lsPk++v++eqe++hn++++++r++eal++y alfd+le+++pr   er+kvE++l+g+ei+n++aceg+er+erhe+lek
  Prupe.2G028700.5.p 308 MGSFLTSLWGLSPKLMVITEQESNHNGHTLMDRIMEALNFYGALFDCLESTVPRSPMERQKVEKMLFGEEIKNIIACEGTERTERHEKLEK 398
                         778**************************************************************************************** PP

                GRAS 315 WrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         W  rle aGF+ vpls++ + qa++ l+ ++  g++++ee+g+lv++W+drpL+s+SaWr
  Prupe.2G028700.5.p 399 WILRLELAGFGRVPLSYHGMLQARRQLQGYE--GFKIKEENGCLVICWHDRPLFSISAWR 456
                         ******************************9..**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.51418438IPR005202Transcription factor GRAS
PfamPF035141.9E-13444456IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MAQEDGSPVT SSPLQFFPWL SPGMGSPYPT WLRELKSEER GLYLIQLLYS CANHVASGSI  60
ENANIWLDHI SQLASPDGDT MQRIAAYFNE ALADRMLKAW PGLYKALNST KITSVSEEIL  120
VKRLFCDLCP FLKVAYVVTN QAIVEAMEGE KMVHIIDLHS CEPAQWIYLI QTLNARPEGP  180
PHLRITGIHE QKEVLDQMFH RLTEEAGNLN IPFQFNPIVS KLENLDIESL RVKTGEALAV  240
CSVLQLHSLL AADDDLRRKS PLASKNLQKV LHMNKLTLGE WLEKDPISAY NLSPDSALSP  300
LSGGSPKMGS FLTSLWGLSP KLMVITEQES NHNGHTLMDR IMEALNFYGA LFDCLESTVP  360
RSPMERQKVE KMLFGEEIKN IIACEGTERT ERHEKLEKWI LRLELAGFGR VPLSYHGMLQ  420
ARRQLQGYEG FKIKEENGCL VICWHDRPLF SISAWRFRRY E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-43444564375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245677.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008245676.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008231437.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008231436.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_008231435.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_007217978.10.0hypothetical protein PRUPE_ppa005439mg
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLM5WZE40.0M5WZE4_PRUPE; Uncharacterized protein
STRINGVIT_13s0019g01220.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3