PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G587100.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 376aa    MW: 42136.5 Da    PI: 9.1614
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G587100.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM94.61.6e-2957954128
                 NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++ + +glkktLvfy+g+apkg +t+W+m+eyrl
  Prupe.1G587100.4.p   5 GEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSENFRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 79 
                         689**********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.8351100IPR003441NAC domain
SuperFamilySSF1019411.7E-33399IPR003441NAC domain
PfamPF023653.9E-12979IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MAAIGEKEWF FYVPRDRKYR NGDRPNRVTT SGYWKATGAD RMIRSENFRS IGLKKTLVFY  60
SGKAPKGIRT SWIMNEYRLP HHETERYQKG EISLCRVYKR AGVEDHPSLP RSLPASKAST  120
SRSSVLVAPS TTISSDNKKQ HNTSTNINNN NINTVHSIME KLQAFNEGQS QQFHQDHEHQ  180
VDQKMSVEPE GSSGNSDVTT VLGLSKRNAY HHNNIGQAHH HPLDQEEGMA AFLHQSNSKQ  240
AAANCFSLIP SSTNSSATLF TAGSSSVSSS NMNAIDDLHR LLTYQHVQQQ AAAASSHHQQ  300
QHVHHHVVQY YDDAHHHPQP NNLFSTFPAV APHVQSAIPP QQLAPNALPT AFSDRLWDWN  360
PISDPNRPDY NNPFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-34210066165NO APICAL MERISTEM PROTEIN
1ut4_B7e-34210066165NO APICAL MERISTEM PROTEIN
1ut7_A7e-34210066165NO APICAL MERISTEM PROTEIN
1ut7_B7e-34210066165NO APICAL MERISTEM PROTEIN
4dul_A7e-34210066165NAC domain-containing protein 19
4dul_B7e-34210066165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G587100.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007225578.20.0NAC domain-containing protein 35 isoform X1
TrEMBLA0A251RKB20.0A0A251RKB2_PRUPE; Uncharacterized protein
TrEMBLA0A251RKE50.0A0A251RKE5_PRUPE; Uncharacterized protein
STRINGXP_008218619.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.14e-73NAC domain containing protein 35