PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G575800.1.p
Common NamePRUPE_ppa006939mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 390aa    MW: 43968.4 Da    PI: 8.0433
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G575800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1248.7e-082432891763
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         A+rsR RK+++i+eLe+ v++L+ae +    ele l+++   l +e+
  Prupe.1G575800.1.p 243 AQRSRVRKLQYIAELERNVQALQAEGSGVTAELEFLNQQNLILSMEN 289
                         89**********************************99998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0011232291IPR004827Basic-leucine zipper domain
CDDcd147031.30E-14235282No hitNo description
SuperFamilySSF579591.63E-5243285No hitNo description
Gene3DG3DSA:1.20.5.1709.5E-6243285No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MANSKSSNIR NFMYSGKHPL LPPKSPFPSV SPSYADYVLS PAFGSKTVQK PREGNAHHQR  60
TSSESLLIEE QPSWLDDLLN EPDTPIRRGG HRRSSSDSFA YVDTSNASNI DYAAQDEYKY  120
HHMISAPSWG SHDFDPQKDL RHASLYTELN LVKQKNKAWE SSLNSVNNMS SLPSVKDNIV  180
LQSSGSLSTP QEADGFASTA SEKQDQVESG PHDPKASSEK KDNSNAKLYA SETDAKRAKQ  240
QFAQRSRVRK LQYIAELERN VQALQAEGSG VTAELEFLNQ QNLILSMENK ALKQRLESIA  300
QEQLIKYLEQ ELLEREIGRL RALYQQQQQH HQQQQQQQQQ QQQQQQQQQP SSSHRRSNSK  360
DLDSQFANLS LKHKDANAGR DPVTGTLRI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.50255e-83fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G575800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007223048.10.0uncharacterized protein At4g06598
SwissprotQ8W3M77e-65Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLM5XDQ10.0M5XDQ1_PRUPE; Uncharacterized protein
STRINGEMJ242470.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51232637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.24e-99bZIP family protein
Publications ? help Back to Top
  1. Kumekawa N,Hosouchi T,Tsuruoka H,Kotani H
    The size and sequence organization of the centromeric region of Arabidopsis thaliana chromosome 4.
    DNA Res., 2001. 8(6): p. 285-90
    [PMID:11853315]