PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G508200.1.p
Common NamePRUPE_ppa024363mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 316aa    MW: 35525.9 Da    PI: 7.2975
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G508200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1444.7e-14245288548
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                         +r++r++kNRe+A rsR+RK+a++ eLe +v +L + N+ Lkk+
  Prupe.1G508200.1.p 245 RRQKRMIKNRESAARSRARKQAYTNELEHEVFQLGKVNSWLKKQ 288
                         79************************************999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.1E-10240309IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.783243288IPR004827Basic-leucine zipper domain
PfamPF001706.4E-12245288IPR004827Basic-leucine zipper domain
CDDcd147078.89E-22245290No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-13245289No hitNo description
SuperFamilySSF579591.48E-10245290No hitNo description
PROSITE patternPS000360248263IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MEDRTLESGN GGERPQFPPL ARQESYNLSN LDEAQSHLGN INSKNGMHFD ELLKNVISVE  60
EGQQLQNPSS SSLPASFFLG NFNLNGALSR KTADEVWKEI AHHEHVNTVV ANESLQQRLS  120
TIGETPATPE HFLVRAGVIN IGNQPSLMNA AQPIMGIDPT VVSQQTDWLQ FQMAAVQQQM  180
TMLDSNLKVR ESVYENSAVN FDYSENQVGM SMPMPAISAS SCESRATAVR KRHFSDEMKE  240
RTIERRQKRM IKNRESAARS RARKQAYTNE LEHEVFQLGK VNSWLKKQKE VEMILASNPT  300
SMPKYQLRRT SSAPY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G508200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007224746.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM5Y2K00.0M5Y2K0_PRUPE; Uncharacterized protein
STRINGEMJ259450.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.18e-46ABA-responsive element binding protein 3