PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G508100.7.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 366aa    MW: 40496.2 Da    PI: 6.0604
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G508100.7.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.12.8e-1180119342
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeN 42 
                         ++k++rr+++NReAAr+sR RKka++++Le+   +L +  
  Prupe.1G508100.7.p  80 SDKVQRRLEQNREAARKSRMRKKAYVQQLETSRLKLAQLE 119
                         79****************************8544443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.4E-1075128No hitNo description
SMARTSM003383.3E-578138IPR004827Basic-leucine zipper domain
PfamPF001704.0E-880120IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.40480124IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.7E-882123No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
PfamPF141441.9E-26171244IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MLQERMSYPS TQFATSRQMG IYEPFRQVGV WKETFRGDHS SNTGASSILE VDAGIETKIG  60
YVSHESLAPS GNDQEPNRSS DKVQRRLEQN REAARKSRMR KKAYVQQLET SRLKLAQLEQ  120
ELERARKQGA YVASSLGTSH MGYNGALNSG ITTFEMEYGH WVEEQHRQNV ELRNALQDHG  180
TDIELLRILV ESGLSHYANL FRMKADAARA DAFYLLSGIW RTSVERHFHW IGGFRPSELL  240
NIVLPQLQPL DEPQLVDFYN LRQSSQQAED ALTQGMEKLQ QNLALTIAGD QISGEIYGSQ  300
MATALEKLEA LETFVGQTGG SPPAANSAAN VSNPNDSPGS SRLACARGIL SPAACPQFSL  360
DCPSS*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAPTransfer from AT1G77920Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G508100.7.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007222089.20.0transcription factor TGA7 isoform X3
SwissprotQ93ZE21e-119TGA7_ARATH; Transcription factor TGA7
TrEMBLA0A251RFY60.0A0A251RFY6_PRUPE; Uncharacterized protein
STRINGEMJ232880.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.11e-114bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]