PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G501500.1.p
Common NamePRUPE_ppa018977mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 507aa    MW: 55337.3 Da    PI: 5.1996
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G501500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.92.1e-1041174971374
                GRAS   1 lvelLlecAeavssgdle..laqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklfs 85 
                         lv+lL+++Aea++  +++  la+ +L rl+el+sp++ ++m+RlaayfteAL+  l + +    k l  + t++++    ++++aa++l++
  Prupe.1G501500.1.p 117 LVHLLMAVAEALTGANKSrdLARVILVRLKELVSPTDgTNMERLAAYFTEALQGLLEGAGGVQGKHLIGNGTHRDHghhPTDVIAAFQLLQ 207
                         68**********997776669***********9987769******************966655566644444444445699********** PP

                GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesg....skeeleetgerLakfAe 170
                         ++sP++kf+h+taNqaIleav +++rvH++D+di++G+QW++L+qaL sR++gpp  +lRiT++++  sg    s  +++etg+rL+ fA+
  Prupe.1G501500.1.p 208 DMSPYVKFGHFTANQAILEAVVHDRRVHVLDYDIMEGIQWASLMQALVSRKDGPPtpHLRITALSRGGSGsgrrSIGTIQETGRRLTAFAA 298
                         ***************************************************776556*********888788988999************* PP

                GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nsesFlerflea 260
                         ++g pf+f+    ++ e++++++L++ +gEal++n++l+l ++  +s ++     ++L+  k+l+P++v++ve+e+   +++ F++rf+++
  Prupe.1G501500.1.p 299 SIGQPFSFHQCRLDSDETFRPSALKLVKGEALVINCMLNLPHFGYRSPDSIA---SFLSGAKTLNPRLVTLVEEEVRPtGDGGFVARFMDS 386
                         **********9999*****************************976666555...9*******************9988************ PP

                GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351
                         l++ysa++dslea++p +s++r+ vEr++lg++i   +a   ++   + e   +W+e+l+++GFkp+p+s  + +qaklll  ++ dgyrv
  Prupe.1G501500.1.p 387 LYHYSAVYDSLEAGFPMQSRARALVERVFLGPRIAGSLARIYRA---NGEVGCSWSEWLGAVGFKPMPISFANHCQAKLLLGLFN-DGYRV 473
                         ******************************************99...889999********************************.***** PP

                GRAS 352 eee.sgslvlgWkdrpLvsvSaWr 374
                         ee  ++ lvlgWk+r L+s+S W+
  Prupe.1G501500.1.p 474 EEVsNHRLVLGWKSRCLLSASIWT 497
                         *76377899**************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.35591477IPR005202Transcription factor GRAS
PfamPF035147.3E-102117497IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MAMAIDQTLG GHAFDLDLSG CSTTTNNTMS SDHWYDWSPV VDWDALPPTD QLAGDDFHEL  60
IESMMEDQEG TELNSSSAQD EVHELEASND TTSSGEIMML TEEDGGANGE DSKGLRLVHL  120
LMAVAEALTG ANKSRDLARV ILVRLKELVS PTDGTNMERL AAYFTEALQG LLEGAGGVQG  180
KHLIGNGTHR DHGHHPTDVI AAFQLLQDMS PYVKFGHFTA NQAILEAVVH DRRVHVLDYD  240
IMEGIQWASL MQALVSRKDG PPTPHLRITA LSRGGSGSGR RSIGTIQETG RRLTAFAASI  300
GQPFSFHQCR LDSDETFRPS ALKLVKGEAL VINCMLNLPH FGYRSPDSIA SFLSGAKTLN  360
PRLVTLVEEE VRPTGDGGFV ARFMDSLYHY SAVYDSLEAG FPMQSRARAL VERVFLGPRI  420
AGSLARIYRA NGEVGCSWSE WLGAVGFKPM PISFANHCQA KLLLGLFNDG YRVEEVSNHR  480
LVLGWKSRCL LSASIWTSPS ESDFVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4415449637374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007226747.10.0hypothetical protein PRUPE_ppa018977mg
SwissprotQ5NE240.0NSP2_MEDTR; Nodulation-signaling pathway 2 protein
TrEMBLM5XQY10.0M5XQY1_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s15900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62643152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-164GRAS family protein