PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G455300.1.p
Common NamePRUPE_ppa007814mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 355aa    MW: 38606.6 Da    PI: 4.9228
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G455300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.59.4e-16186237354
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                         ++kr rr+ +NRe+ArrsR+RK+a+++ Le  v++L +eN++L  +l   ++
  Prupe.1G455300.1.p 186 DIKRIRRMVSNRESARRSRRRKQAQLADLEFQVEQLRGENSTLYRQLTDASQ 237
                         58*****************************************955544444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575124No hitNo description
SMARTSM003382.8E-14184248IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.093186249IPR004827Basic-leucine zipper domain
PfamPF001703.6E-13187233IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.5E-9188225No hitNo description
SuperFamilySSF579591.93E-11188238No hitNo description
PROSITE patternPS000360191206IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.101.4E-4226258No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MEQKHVAMCS AAHSQLTSSS LFACSELKQS TSEFSLSEAL EFLDRSMIGQ EAADTQSYKD  60
EKLGEFRAYV RDRNFADTEV LFGDVWAGDL SFDFKSRDIM NGFSSSGELT ETLLCTQNLT  120
PKNSSISATM DSQSSICVGS PTSAAKPIAR DNQARGAESG SSGDQSDEDD FEIEAGPCGD  180
STDPLDIKRI RRMVSNRESA RRSRRRKQAQ LADLEFQVEQ LRGENSTLYR QLTDASQQFR  240
DADTNNRVLK SDVEALRAKV KLAEDMVARG SITTSLNQIR QGHLGTPQQF NPHNLRGVAQ  300
VSPTVTIHGD DARYAGMAVS GQNGGLGLGN AGMANSNLSN RIMSNTVSCV SDIW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1200207RRSRRRKQ
2202207SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.58320.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Present in silique vasculature and funiculi. In the anthers, restricted to the connective tissue at pre- and post-dehiscence stages and detected in the vascular tissue of the stamen filament. {ECO:0000269|PubMed:18841482}.
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, stems, young leaves, and flowers, mostly in vascular tissues (e.g. phloem). {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G455300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by glucose. {ECO:0000269|PubMed:18841482}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007222209.10.0basic leucine zipper 9
SwissprotQ9FUD32e-75BZIP9_ARATH; Basic leucine zipper 9
TrEMBLM5XPF80.0M5XPF8_PRUPE; Uncharacterized protein
STRINGEMJ234080.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41953458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.12e-54basic leucine zipper 9
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ortiz-EspĂ­n A, et al.
    Mitochondrial AtTrxo1 is transcriptionally regulated by AtbZIP9 and AtAZF2 and affects seed germination under saline conditions.
    J. Exp. Bot., 2017. 68(5): p. 1025-1038
    [PMID:28184497]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]