PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G454900.3.p
Common NamePRUPE_ppa025916mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 343aa    MW: 38086.9 Da    PI: 9.1451
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G454900.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1761.1e-5491361128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePw+Lp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke
  Prupe.1G454900.3.p   9 LPPGFRFHPTDEELITFYLINKITDATFTG-RAIADVDLNKCEPWELPAKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKE 98 
                         79*************************999.89***************99999************************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++ ++e vg+kktLvfy+grap+gek++Wvmheyr+
  Prupe.1G454900.3.p  99 IFNSvTSEMVGMKKTLVFYRGRAPRGEKSNWVMHEYRI 136
                         **9989999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-636157IPR003441NAC domain
PROSITE profilePS5100560.1439157IPR003441NAC domain
PfamPF023653.8E-2810136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MTGEQKEELP PGFRFHPTDE ELITFYLINK ITDATFTGRA IADVDLNKCE PWELPAKAKM  60
GEKEWYFFSL RDRKYPTGVR TNRATNTGYW KTTGKDKEIF NSVTSEMVGM KKTLVFYRGR  120
APRGEKSNWV MHEYRIHSKS AFRTSKDEWV VCRVFQKSAG IKKYPTTQSR AANPYNLEIG  180
PSVVPSPMMQ IGDHQFPYGR NYMTSAELAE ISRVLRNGGS GGGGSSNGTI NVPIQPQFNY  240
PNLGGGGGGF TISGLNLNLG APATQPMLRP MPPPQLHHQG PPAMNPHQQD VMSNGANNNS  300
LGPDHQAGYG AIDMNNNNAN GNGNRFMNME HCVDLDTYWP PY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-54916317171NO APICAL MERISTEM PROTEIN
1ut4_B2e-54916317171NO APICAL MERISTEM PROTEIN
1ut7_A2e-54916317171NO APICAL MERISTEM PROTEIN
1ut7_B2e-54916317171NO APICAL MERISTEM PROTEIN
3swm_A2e-54916320174NAC domain-containing protein 19
3swm_B2e-54916320174NAC domain-containing protein 19
3swm_C2e-54916320174NAC domain-containing protein 19
3swm_D2e-54916320174NAC domain-containing protein 19
3swp_A2e-54916320174NAC domain-containing protein 19
3swp_B2e-54916320174NAC domain-containing protein 19
3swp_C2e-54916320174NAC domain-containing protein 19
3swp_D2e-54916320174NAC domain-containing protein 19
4dul_A2e-54916317171NAC domain-containing protein 19
4dul_B2e-54916317171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G454900.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007226507.10.0NAC domain-containing protein 92
RefseqXP_020416949.10.0NAC domain-containing protein 92
RefseqXP_020416958.10.0NAC domain-containing protein 92
TrEMBLM5XQA30.0M5XQA3_PRUPE; Uncharacterized protein
STRINGEMJ277060.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-109NAC domain containing protein 38