PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G434500.1.p
Common NamePRUPE_ppa006503mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 420aa    MW: 44894.4 Da    PI: 10.3327
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G434500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1491.4e-15342397560
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+  e+ ++ ++ +
  Prupe.1G434500.1.p 342 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELQKKQAEMMEMQKNQD 397
                         79****************************************99999988877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.8E-16335390No hitNo description
SMARTSM003383.3E-13338402IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.346340391IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.81E-11342391No hitNo description
PfamPF001703.8E-13342394IPR004827Basic-leucine zipper domain
CDDcd147071.70E-27342396No hitNo description
PROSITE patternPS000360345360IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MGTNMNFKGF GNDPPGINPL ARQSSIYSLT FEELQNTIGG SGKDFGSMNM DELLKSIWTA  60
EETQIMAPSG GGAGGQNGLG LGGGSLQRQG SLTLPRTLSQ KTVDEVWKNI SKEGTGPGGS  120
NMPQRQQTLG EMTLEEFLVK AGVVREEAQL APKPANNGAG FFGDLSRFGN TGGNLDFEFQ  180
QTNRGVGVMG NRVSETNSQV PNQASNLPLN ANGVRSNQQQ QQLPQQQQIF PKQQPVTYNT  240
SPLPMGPNAQ LGSPGMRGGI MGIGDQGLNG TLVQSSGMGM VGLGAAGAVR VATGSPANQL  300
SSDGIGKSNG TDTSSVSPVP YVFNGGFRGR KGGGPVEKVV ERRQRRMIKN RESAARSRAR  360
KQAYTMELEA EVAKLKEENQ ELQKKQAEMM EMQKNQDMEI INLQRGKKRC LRRTQTGPW*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, flowers and siliques but not in seeds. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in ABA and stress responses and acts as a positive component of glucose signal transduction. Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G434500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA), cold and glucose. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7700610.0KC770061.1 Pyrus pyrifolia microsatellite TXY164 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020425860.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-130AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A251RCU20.0A0A251RCU2_PRUPE; Uncharacterized protein
STRINGXP_008220233.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.12e-92abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Gao S, et al.
    ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis.
    Mol Plant, 2016. 9(9): p. 1272-1285
    [PMID:27373216]
  2. Seok HY, et al.
    Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response.
    Planta, 2017. 245(2): p. 329-341
    [PMID:27770200]