PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G416800.1.p
Common NamePRUPE_ppa008984mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HD-ZIP
Protein Properties Length: 312aa    MW: 35034 Da    PI: 6.548
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G416800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.4e-19152206256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq  +Le+ F+++ +++ +++++LA+kl+L  rqV vWFqNrRa+ k
  Prupe.1G416800.1.p 152 RKKLRLSKEQSATLEDSFREHTTLNPKQKQDLARKLNLRPRQVEVWFQNRRARTK 206
                         788899***********************************************98 PP

2HD-ZIP_I/II121.73.6e-39152239188
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                         +kk+rlskeq+++LE+sF+e+++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E d+e Lk+++++lkeen+rL+ke +eL+
  Prupe.1G416800.1.p 152 RKKLRLSKEQSATLEDSFREHTTLNPKQKQDLARKLNLRPRQVEVWFQNRRARTKLKQTEADCELLKKCCETLKEENRRLHKELQELK 239
                         69*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-18142209IPR009057Homeodomain-like
PROSITE profilePS5007117.427148208IPR001356Homeobox domain
SMARTSM003891.1E-16150212IPR001356Homeobox domain
CDDcd000864.20E-16151209No hitNo description
PfamPF000462.9E-16152206IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-17152206IPR009057Homeodomain-like
PROSITE patternPS000270183206IPR017970Homeobox, conserved site
PfamPF021831.8E-8208242IPR003106Leucine zipper, homeobox-associated
SMARTSM003409.3E-17208251IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MSFDEACNTG LGLSLGCRDS PDHDHTNLQA PPDHHHHHHQ NTYKNKQIQL KYDHLLPSLT  60
LGPSAASKIE EAESTDLHQA VAAQEQDSSP CSGAFSSFSN SSSFKRDREL GGEEIEVEVE  120
VEVEVEEERV VNITSSRASE ELYEQDHEGS PRKKLRLSKE QSATLEDSFR EHTTLNPKQK  180
QDLARKLNLR PRQVEVWFQN RRARTKLKQT EADCELLKKC CETLKEENRR LHKELQELKL  240
MKQTATAAAA VPPFYMQFPT ATLTMCPSCE KICNGGDHHN HHGSSTSSFL IGSKPAHLIF  300
NPFSTHPSTA C*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1200208RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.16430.0fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G416800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007222987.10.0homeobox-leucine zipper protein HAT22
TrEMBLM5XFE80.0M5XFE8_PRUPE; Uncharacterized protein
STRINGEMJ241860.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.15e-67HD-ZIP family protein