PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G411200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 163aa    MW: 18625.1 Da    PI: 7.1884
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G411200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601185.5e-3761052101
              DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                         CaaC+++r+kC++dC +apyfpa++ ++f n+hklFG+ +++k+l+++++++r+ am s+  eAe rardPv G+++ i++l +++++++ 
  Prupe.1G411200.1.p   6 CAACRFQRKKCTEDCLMAPYFPATRFQQFLNAHKLFGVGKITKTLNSVSPQQRSSAMYSVKAEAEYRARDPVGGCYNEIKSLLWKIRTTED 96 
                         ******************************************************************************************* PP

              DUF260  93 elallkeel 101
                         el++++++l
  Prupe.1G411200.1.p  97 ELQHVHSQL 105
                         ****99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.0664105IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-346102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MKHQTCAACR FQRKKCTEDC LMAPYFPATR FQQFLNAHKL FGVGKITKTL NSVSPQQRSS  60
AMYSVKAEAE YRARDPVGGC YNEIKSLLWK IRTTEDELQH VHSQLCMFRA GGENAMAHPL  120
DGYEYNVVQD VEYDSQLHHQ LQQNIVQEQS GVVENHQEQC LI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007224730.11e-112hypothetical protein PRUPE_ppa024836mg, partial
SwissprotQ9LRW14e-38LBD22_ARATH; LOB domain-containing protein 22
TrEMBLM5XJ131e-112M5XJ13_PRUPE; Uncharacterized protein (Fragment)
STRINGAT3G13850.19e-36(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3976022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-39LOB domain-containing protein 22