PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G391400.2.p
Common NamePRUPE_ppa024819mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 612aa    MW: 67312.1 Da    PI: 6.789
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G391400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.43.3e-28154207155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Prupe.1G391400.2.p 154 KPRVVWSLELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 207
                         79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011013.752183IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23002.9E-51046No hitNo description
SuperFamilySSF521722.35E-121790IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.8E-1147102No hitNo description
PROSITE profilePS5129411.849151210IPR017930Myb domain
SuperFamilySSF466891.08E-19151211IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-30152212IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-25154207IPR006447Myb domain, plants
PfamPF002491.3E-6156206IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MTVEGVLDEP RDQFPIGMRV LAVDDDPICL KLLDALLRRC KYHVLSANGD TKLVMKGITH  60
GACDYLLKPV RIEQLKNIWQ HVIRRKKVDS KDQNSCNQEK SHAGNGEGGP GSAGTGNSDQ  120
NAKLNKKRKD QDEDEDDDRD EDGHDNDDPS TQKKPRVVWS LELHRKFVAA VNQLGIDKAV  180
PKKILDLMNV EKLTRENVAS HLQKYRLYLK RISRVANQQA NMVAALGTSD SSYLQMTSVN  240
GVGNFHPLTG PGQFHNNAFR SFPPSGMVGR LNTPAGLGLH CLPSSGMFQL SHAQNPSNSI  300
NDQPLIFPGN RNGNILPAPL ELDQQHGTEA ACVADFSAAV NGTTVYPTSS GLPDAKVFNS  360
SNDALGLADN PILRHTRDSE VGRNYVNQSS VSRASLRSEL SPPFLDHGRL NDNWSSASQP  420
SMFCSNSFSS RDSFKQATLL QSNLKDNMPV MSSQIGSSQI DVSISCQSQD SRFGLPIQAS  480
AISNNSGQTI NNDPFQGWDD HKPDSQYPSD VMCTSMNSLM PVNDTVAPFD QNSDSRRTSF  540
QRNMGFNSIG QSNFLDPLLM KYDNVEPTQD ASLKMRPGYL MDQRKLQGGY NPNNVGSLDE  600
LVSAMMKQER R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-26150213164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1205214RLYLKRISRV
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G391400.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007226815.20.0two-component response regulator ARR12
TrEMBLA0A251RA130.0A0A251RA13_PRUPE; Two-component response regulator
STRINGEMJ280140.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.12e-88response regulator 12