PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G391400.1.p
Common NamePRUPE_ppa024819mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family ARR-B
Protein Properties Length: 663aa    MW: 73070 Da    PI: 6.5123
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G391400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.23.7e-28205258155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Prupe.1G391400.1.p 205 KPRVVWSLELHRKFVAAVNQL-GIDKAVPKKILDLMNVEKLTRENVASHLQKYRL 258
                         79*******************.********************************8 PP

2Response_reg776.7e-26201281109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ ++ll  +l++ +y +v++++++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ + 
  Prupe.1G391400.1.p  20 VLAVDDDPICLKLLDALLRRCKY-HVTTTSQAIMALKLLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKLVMKG 108
                         799********************.***************888888*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +e+l +
  Prupe.1G391400.1.p 109 ITHGACDYLLKPVRIEQLKN 128
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.9E-1681662IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.1E-4117153No hitNo description
SuperFamilySSF521728.54E-3517141IPR011006CheY-like superfamily
SMARTSM004487.7E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.37219134IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.6E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.98E-2721134No hitNo description
PROSITE profilePS5129411.849202261IPR017930Myb domain
SuperFamilySSF466891.2E-19202262IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-30203263IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-25205258IPR006447Myb domain, plants
PfamPF002491.4E-6207257IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MTVEGVLDEP RDQFPIGMRV LAVDDDPICL KLLDALLRRC KYHVTTTSQA IMALKLLREN  60
KNKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTKLVMKGIT HGACDYLLKP  120
VRIEQLKNIW QHVIRRKKVD SKDQNSCNQE KSHAGNGEGG PGSAGTGNSD QNAKLNKKRK  180
DQDEDEDDDR DEDGHDNDDP STQKKPRVVW SLELHRKFVA AVNQLGIDKA VPKKILDLMN  240
VEKLTRENVA SHLQKYRLYL KRISRVANQQ ANMVAALGTS DSSYLQMTSV NGVGNFHPLT  300
GPGQFHNNAF RSFPPSGMVG RLNTPAGLGL HCLPSSGMFQ LSHAQNPSNS INDQPLIFPG  360
NRNGNILPAP LELDQQHGTE AACVADFSAA VNGTTVYPTS SGLPDAKVFN SSNDALGLAD  420
NPILRHTRDS EVGRNYVNQS SVSRASLRSE LSPPFLDHGR LNDNWSSASQ PSMFCSNSFS  480
SRDSFKQATL LQSNLKDNMP VMSSQIGSSQ IDVSISCQSQ DSRFGLPIQA SAISNNSGQT  540
INNDPFQGWD DHKPDSQYPS DVMCTSMNSL MPVNDTVAPF DQNSDSRRTS FQRNMGFNSI  600
GQSNFLDPLL MKYDNVEPTQ DASLKMRPGY LMDQRKLQGG YNPNNVGSLD ELVSAMMKQE  660
RR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-26201264164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256265RLYLKRISRV
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G391400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007226815.20.0two-component response regulator ARR12
SwissprotA2X1N21e-142ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A251RA030.0A0A251RA03_PRUPE; Two-component response regulator
STRINGEMJ280140.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-131response regulator 12