PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G390000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 232aa    MW: 26255.8 Da    PI: 9.3689
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G390000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM44.45.4e-14328673128
                 NAM  73 rknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++n+ t++gyW+a+g+  +++s +++ +g + ++ fy+g++p+ +kt+Wvm+ey +
  Prupe.1G390000.1.p  32 NENKPTEHGYWRAKGEACRIFS-NSSMTGWRAIIEFYQGQSPHESKTNWVMQEYWI 86 
                         5678899***************.9999***************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100516.2661104IPR003441NAC domain
SuperFamilySSF1019415.36E-152591IPR003441NAC domain
PfamPF023651.6E-72684IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MSIINLKITS GRILLRSHLL VLFWDWYFIL SNENKPTEHG YWRAKGEACR IFSNSSMTGW  60
RAIIEFYQGQ SPHESKTNWV MQEYWITQKK LSKDSKPKTR FMPEIDYVSR DSSCLTMSSD  120
ECFDSLALLE ELEPKNSPYL VNNNAGCKFS ISAPLRADEL VMFAASSGSF SKSPSEERIK  180
THSPIHGAVC GKISGKTSNN MSRIQKPEYR NEGGPSTFHN VAVSPRRKKE G*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G390000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007223100.12e-55NAC domain-containing protein 79
RefseqXP_020410597.12e-55NAC domain-containing protein 79
TrEMBLA0A251R9Y71e-172A0A251R9Y7_PRUPE; Uncharacterized protein
STRINGEMJ255641e-155(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105882235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.21e-12NAC domain containing protein 80