PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G387800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 324aa    MW: 35570.6 Da    PI: 8.6102
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G387800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.2e-32141194255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Prupe.1G387800.1.p 141 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 194
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.56E-15138195IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-28139195IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23141194IPR006447Myb domain, plants
PfamPF002492.0E-7142193IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MYLMNPIKRT STSPLPDLSL QISPPSAADN QYHQADIGLS RKALYSTDRS STTDSGSSGS  60
DLSHENGFYH LERSTGYNLS SADEPKLSLG FEMKDHMSLP PVQLPRNFSN HHFHHHPQIY  120
GRQFKRNART VGNVKRSIRA PRMRWTTTLH AHFVHAVQLL GGHERATPKS VLELMNVKDL  180
TLAHVKSHLQ MYRTVKSTDN KGTGHEGQTD MGLNQKPGIN GGLSCDKANR GSWPSSSETN  240
GSCNLSPGNA LTYSHSPQSN GTKVEEEESG RHVCDDGVGM KERGTTLACG SLSASDMYLN  300
LEFTLGRPTA EWTVLNSLNL QMT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16142196357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16142196357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16142196357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16142196357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16142196458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G387800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2834720.0KP283472.1 Prunus armeniaca aberrant testa shape (ATS) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020410100.10.0probable transcription factor KAN4
TrEMBLA0A251RA190.0A0A251RA19_PRUPE; Uncharacterized protein
STRINGXP_008220727.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.11e-55G2-like family protein