PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G383200.2.p
Common NamePRUPE_ppa007090mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 383aa    MW: 42309.4 Da    PI: 6.8266
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G383200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM61.72.3e-19111174128
                 NAM   4 GfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                          + F+ tdeel    L k ++g++l+  +vi++++ y++ P++Lp      +  wyf +++++k          t+ gyW+++g+  +++s
  Prupe.1G383200.2.p  11 DIGFQCTDEELC-ISLGKIISGSPLPG-NVIEDANPYQLVPSNLP------DGFWYFIHSNENK---------PTNFGYWRTKGEACRIFS 84 
                         56799******9.66***********9.99**************9......3568888887654.........4778************** PP

                 NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++ +g + tL fy+g+ap+ +ktdWvm+ey l
  Prupe.1G383200.2.p  85 -NSSITGWRATLEFYQGQAPNESKTDWVMQEYWL 117
                         .999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-266140IPR003441NAC domain
PROSITE profilePS5100527.1948140IPR003441NAC domain
PfamPF023651.6E-1011116IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MCPQSATLPA DIGFQCTDEE LCISLGKIIS GSPLPGNVIE DANPYQLVPS NLPDGFWYFI  60
HSNENKPTNF GYWRTKGEAC RIFSNSSITG WRATLEFYQG QAPNESKTDW VMQEYWLTQK  120
KLSEDSKAKE PRSLCRVFCS NEQKLNCKNL QKMVSSDSAT YSAHSAVPRA KNCTSHSSTS  180
KPQVSKDNER GTLIVTERVP DHDVQIMPEI DYVSRGDYLE LLDLDTPASF SFSSDSSCLT  240
MSSDECFDSL ALLEELEPKN SQDLVNKNAG CKFSISAPPR PDELVIFAAS SGSFSKSPSE  300
ERVKTHSPIP GSAVCGKISG KTSNNMNRIQ KPDCRNEGGP STSHNVDVSP SSHTASQEGK  360
RRARTIGRTE KLKKKYFCFM PF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G383200.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007223100.10.0NAC domain-containing protein 79
RefseqXP_020410597.10.0NAC domain-containing protein 79
TrEMBLA0A251RCE00.0A0A251RCE0_PRUPE; Uncharacterized protein
STRINGEMJ242990.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.16e-20NAC domain containing protein 28