PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G383200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 420aa    MW: 46447.2 Da    PI: 7.0665
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G383200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM61.52.8e-19481544128
                 NAM   4 GfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                          + F+ tdeel    L k ++g++l+  +vi++++ y++ P++Lp      +  wyf +++++k          t+ gyW+++g+  +++s
  Prupe.1G383200.1.p  48 DIGFQCTDEELC-ISLGKIISGSPLPG-NVIEDANPYQLVPSNLP------DGFWYFIHSNENK---------PTNFGYWRTKGEACRIFS 121
                         56799******9.66***********9.99**************9......3568888887654.........4778************** PP

                 NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +++ +g + tL fy+g+ap+ +ktdWvm+ey l
  Prupe.1G383200.1.p 122 -NSSITGWRATLEFYQGQAPNESKTDWVMQEYWL 154
                         .999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-2641177IPR003441NAC domain
PROSITE profilePS5100527.19445177IPR003441NAC domain
PfamPF023651.9E-1048153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MALIGGSFSV VERLRVEIRN EQEKAVALWS SQNPKVIMCP QSATLPADIG FQCTDEELCI  60
SLGKIISGSP LPGNVIEDAN PYQLVPSNLP DGFWYFIHSN ENKPTNFGYW RTKGEACRIF  120
SNSSITGWRA TLEFYQGQAP NESKTDWVMQ EYWLTQKKLS EDSKAKEPRS LCRVFCSNEQ  180
KLNCKNLQKM VSSDSATYSA HSAVPRAKNC TSHSSTSKPQ VSKDNERGTL IVTERVPDHD  240
VQIMPEIDYV SRGDYLELLD LDTPASFSFS SDSSCLTMSS DECFDSLALL EELEPKNSQD  300
LVNKNAGCKF SISAPPRPDE LVIFAASSGS FSKSPSEERV KTHSPIPGSA VCGKISGKTS  360
NNMNRIQKPD CRNEGGPSTS HNVDVSPSSH TASQEGKRRA RTIGRTEKLK KKYFCFMPF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G383200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007223100.10.0NAC domain-containing protein 79
RefseqXP_020410597.10.0NAC domain-containing protein 79
TrEMBLA0A251R9L70.0A0A251R9L7_PRUPE; Uncharacterized protein
STRINGEMJ242990.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105882235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.18e-20NAC domain containing protein 28