PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G369300.2.p
Common NamePRUPE_ppa003452mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 574aa    MW: 62637 Da    PI: 7.0974
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G369300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1331.3e-10408468363
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         + kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +  +l+  +  l+se+
  Prupe.1G369300.2.p 408 DPKRAKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQFTKLQRDSVGLTSEN 468
                         569*****************************************99999998887777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.6E-17406470IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.588408471IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.77E-10410461No hitNo description
PfamPF001704.9E-9410468IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-10410461No hitNo description
CDDcd147032.95E-22411460No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MEGSDETGSV KQRPNSTFGS SSFSVPKPNS HLEIPNFNSA QMGLPMRQSS PSLSPENSKR  60
PGIPPSHPNN HNSMPFSHIM RPQSGSWQLG PQNLSSVPSH TRSLSQPSFF SLNSLPPLSP  120
LPYREPSSSS LSDPNSVDVS MDETVVNSHA PSLRSPVTTD SNAFWAGDGL PPRRGHRRSN  180
SDVPLGFSAV IQSSPQLIPI GRRTSLDGSA SGRENLGIGK PVQLVKRGSN GDRDGNKNAE  240
GMDERKSGGE VVDDLFNAYM NLDNIEKMNS SGNDDKDLDS RASGSKTNGG ESSDNEVESG  300
LNGNRYNGQR PASGFPSEKR EGVKRTASGD VVPNVRHCRS ISMDSYMENL NFDDEPLKPL  360
PAGQQSPSAS LDGNSGKFSM EFGSGEFNAI ELRKIMESEK LAEIAQSDPK RAKRILANRQ  420
SAARSKERKM RYIVELEHKV QTLQTEATTL SAQFTKLQRD SVGLTSENNE LKFRLQALEQ  480
QAQLKDALNE ALTGEVQRLK LAAAEIGGEG HLSINQQMLQ LQHLNLYQMQ QQPQHQSQQH  540
TQQQFMQPQQ NRQPSHQQNG NGNAAAAKHE SSE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G369300.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007221799.10.0transcription factor RF2a
TrEMBLM5XNC00.0M5XNC0_PRUPE; Uncharacterized protein
STRINGEMJ229980.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-113bZIP family protein