PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G340500.1.p
Common NamePRUPE_ppa021540mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 302aa    MW: 33632.3 Da    PI: 8.7245
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G340500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-312073255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtpeLH++F++ +e+LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Prupe.1G340500.1.p 20 PRLRWTPELHHCFLHSIERLGGHKKATPKLVLQLMDVKGLTISHVKSHLQMYRS 73
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.121676IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-301675IPR009057Homeodomain-like
SuperFamilySSF466898.06E-151873IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-222073IPR006447Myb domain, plants
PfamPF002492.2E-72172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MTSCSARNGA VRQYVRSKVP RLRWTPELHH CFLHSIERLG GHKKATPKLV LQLMDVKGLT  60
ISHVKSHLQM YRSMRGDLGT RQQVTDRSCT QPRKQLFEEH DDGCLDELNG VSFYPSSKSI  120
RESDSQLIYS TPRRSKRART ETTSSISEGL QQQCSQGIYE TVSNPYSFDD NVLAMAQQQR  180
GGFKEPNPSA LSLPQPHLHY NFNHPSSQFS LQESDFFKVT KPEARADADQ DNEDGDCQLS  240
LSLSLHHPSS HKSKSNASSS EFSGAISSYS SSRSNYKDCS TSSSGNHRSI NLNLSIALCG  300
K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-182175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-182175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-182175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-182175357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G340500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020410534.10.0putative Myb family transcription factor At1g14600 isoform X1
TrEMBLA0A251R7F60.0A0A251R7F6_PRUPE; Uncharacterized protein
STRINGXP_008220974.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.13e-31G2-like family protein