PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G329600.1.p
Common NamePRUPE_ppa005944mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 437aa    MW: 48095.8 Da    PI: 6.8321
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G329600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS454.47.3e-139684271374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         lv+ L++cA+av++++l+la+al++++  la +++ +m+++a+yf+eALa+r++r    +y    p++    ++s + + +  f+e++P+l
  Prupe.1G329600.1.p  68 LVHGLMACAKAVQQNNLNLAKALVTQIGYLAISQAGAMRKVATYFAEALAQRIFR----VY----PQSPI--DHSFSDMLQMHFYETCPYL 148
                         6899***************************************************....44....33333..23444444556******** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         kf+h+taNqaIlea++g++rvH+iDf+++qG+QWpaL+qaLa Rp+gpp +R+Tg+g+p+s++++ l+e+g++La++Ae+++v+fe++ +v
  Prupe.1G329600.1.p 149 KFAHFTANQAILEALQGKTRVHVIDFSMNQGMQWPALMQALALRPGGPPAFRLTGIGPPASDNSDHLQEVGWKLAQLAETIHVEFEYRGFV 239
                         ******************************************************************************************* PP

                GRAS 183 akrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         a++l+dl+ ++L+++p   E++aVn+v++lh+ll++++++e+    vL++vk+++P++v+vveqea+hn++ F++rf e+l+yys+lfdsl
  Prupe.1G329600.1.p 240 ANSLADLDASMLELRPseVESVAVNSVFELHKLLARPGAIEK----VLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSL 326
                         ****************88899*********************....********************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlg 361
                         e ++   +++++ +++ +lg++i+nvvaceg +r+erhetl +Wr rl++ GF pv+l+++a kqa++ll+ ++ +dgyrvee++g+l+lg
  Prupe.1G329600.1.p 327 EGSV---NSQDKAMSELYLGKQICNVVACEGVDRVERHETLTQWRTRLDSGGFVPVHLGSNAFKQASMLLALFAgGDGYRVEENNGCLMLG 414
                         ***7...88889999999************************************************************************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         W++rpL+++SaW+
  Prupe.1G329600.1.p 415 WHTRPLIATSAWK 427
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.94742406IPR005202Transcription factor GRAS
PfamPF035142.5E-13668427IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MFPQTHHDSS SREAKRLKPS SGSSASDLVF NRRTASSLPQ PQPLSIPTTE SSTRPALLVD  60
SQENGVRLVH GLMACAKAVQ QNNLNLAKAL VTQIGYLAIS QAGAMRKVAT YFAEALAQRI  120
FRVYPQSPID HSFSDMLQMH FYETCPYLKF AHFTANQAIL EALQGKTRVH VIDFSMNQGM  180
QWPALMQALA LRPGGPPAFR LTGIGPPASD NSDHLQEVGW KLAQLAETIH VEFEYRGFVA  240
NSLADLDASM LELRPSEVES VAVNSVFELH KLLARPGAIE KVLSVVKQMK PEIVTVVEQE  300
ANHNGPVFMD RFNESLHYYS TLFDSLEGSV NSQDKAMSEL YLGKQICNVV ACEGVDRVER  360
HETLTQWRTR LDSGGFVPVH LGSNAFKQAS MLLALFAGGD GYRVEENNGC LMLGWHTRPL  420
IATSAWKPGC DSVMAH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-56684274375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007225630.10.0hypothetical protein PRUPE_ppa005944mg
SwissprotQ6EI050.0GAIPB_CUCMA; DELLA protein GAIP-B
TrEMBLM5XLL40.0M5XLL4_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s12080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein