PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G306300.1.p
Common NamePRUPE_ppa007222mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 384aa    MW: 42452 Da    PI: 8.0602
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G306300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.7e-32208263156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Prupe.1G306300.1.p 208 KQRRNWSPELHRRFLHALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 263
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.649205265IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-28206266IPR009057Homeodomain-like
SuperFamilySSF466892.51E-18206266IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26208263IPR006447Myb domain, plants
PfamPF002497.4E-8210261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MESTEQMQAS RLGFRDYVKA LEEERHKIQV FQRELPLCLE LVTQAIERCK QQLSDTTTDY  60
MHGQSECSEQ TSSEGHVFEE FIPLKRTSSS DSDDDEVQES QEPKTNDKDK TNGDKIKSDW  120
LRSAQLWNTT PDPPLKDELP RKALVMEVKR NGGAFQPFQR EKSVGKTNRP VAKVPASAPA  180
TSSTTDTVSG GSGESHKKEE KDGQGQRKQR RNWSPELHRR FLHALQQLGG SHAATPKQIR  240
ELMKVDGLTN DEVKSHLQKY RLHTRRPTPT MHNNNNSDNN TQAPQFLVVG GIWVPPQDYA  300
AVAATTASGE ATRVAAANGI YAPVATSPST VTPVSPPSLM QRPRPKRPES SHSDERVSHS  360
EGRGHCNSTA TSSSTHTTAS PVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-13208261255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-13208261255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-13208261154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-13208261154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-13208261154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-13208261154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-13208261255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-13208261255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-13208261255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-13208261255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-13208261255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-13208261255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.1G306300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007223224.20.0myb family transcription factor EFM
SwissprotQ9FPE81e-107HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A251R5K50.0A0A251R5K5_PRUPE; Uncharacterized protein
STRINGEMJ244230.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-90G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]